KEGG   Carboxydothermus hydrogenoformans: CHY_0968Help
Entry
CHY_0968          CDS       T00287                                 

Gene name
cheB1
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:chy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CHY_0968 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CHY_0968 (cheB1)
Enzymes [BR:chy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CHY_0968 (cheB1)
Two-component system [BR:chy02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CHY_0968 (cheB1)
Bacterial motility proteins [BR:chy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CHY_0968 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
858495..859517
Genome map
AA seq 340 aa AA seqDB search
MSRYKLFIVDDSALIRLRLKTSLALWPEIQIVGEAENGQEALKKIPLVKPDVVTLDLEMP
VLDGLSTLKELNKVYPVPVIMLSSLTTHGAKATIEALENGAVDFVPKDGDWNKVVSELKE
KIKIAVLAKKRPKPFTGGTLNPKNVILGKNGRQLVVIGASTGGPPALREIIPKLPQTFPV
PIVIIQHITRGFSKPLADQLARVSRLKVKEAEKDEQLLPGTVYVAPAGYTFKIDKQGGSL
TAKIIEPVEYLPAHFYPSVDEAMLSAAEVTGSKTIGVLLTGMGKDGALGMKAIKERGGYT
IAQDEETSVVYGMPKAAIDIGGVSRVLPLSAIAEEIAANI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggtataaactttttattgtggatgattcggccttaatccgtctccggctgaag
acaagtctggctttatggcccgaaatccagatagttggggaagcggaaaatggtcaggaa
gctttaaagaaaatcccattagttaagcccgatgtagttacgctggatttagaaatgccg
gtactggatggtcttagtaccttaaaagagttaaacaaagtttatccggtaccggtaatc
atgctttcttctttaacaacccacggagctaaggcaactattgaggccctggaaaatggt
gcggtagattttgtaccaaaagatggggattggaataaggttgtttctgagttaaaagaa
aagataaaaatagctgtcttagctaaaaaacgtccgaaaccttttaccggagggacgctt
aaccccaaaaatgttattctcggtaaaaacggccggcaattggtggtgataggtgcttct
accggtggaccgccggccttacgagaaatcattcccaaacttccgcaaacctttccggtg
cccattgtaattatccagcatattacccgcgggtttagcaagccgctggcggaccagctg
gccagagtttcccggttaaaggtaaaggaagcggaaaaagacgagcagttgctcccggga
acggtctatgtggcccctgccggctatacttttaaaattgataaacaaggaggcagttta
acagctaaaataattgagccggtggaatacttgccggctcatttctacccctccgttgat
gaggcgatgctttcggcagcagaagtgacgggcagcaaaaccataggagttttgctaact
ggcatgggaaaggatggggcgctcgggatgaaagctatcaaagaacggggagggtatacc
attgcccaggacgaagaaacttcggtagtttacggtatgcccaaagcggcaattgatata
gggggagtttctcgggttttgcccctatcggcaattgctgaagaaattgcggccaatatc
taa

DBGET integrated database retrieval system