KEGG   Carboxydothermus hydrogenoformans: CHY_0968Help
Entry
CHY_0968          CDS       T00287                                 

Gene name
cheB1
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:chy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:chy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
858495..859517
Genome map
AA seq 340 aa AA seqDB search
MSRYKLFIVDDSALIRLRLKTSLALWPEIQIVGEAENGQEALKKIPLVKPDVVTLDLEMP
VLDGLSTLKELNKVYPVPVIMLSSLTTHGAKATIEALENGAVDFVPKDGDWNKVVSELKE
KIKIAVLAKKRPKPFTGGTLNPKNVILGKNGRQLVVIGASTGGPPALREIIPKLPQTFPV
PIVIIQHITRGFSKPLADQLARVSRLKVKEAEKDEQLLPGTVYVAPAGYTFKIDKQGGSL
TAKIIEPVEYLPAHFYPSVDEAMLSAAEVTGSKTIGVLLTGMGKDGALGMKAIKERGGYT
IAQDEETSVVYGMPKAAIDIGGVSRVLPLSAIAEEIAANI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggtataaactttttattgtggatgattcggccttaatccgtctccggctgaag
acaagtctggctttatggcccgaaatccagatagttggggaagcggaaaatggtcaggaa
gctttaaagaaaatcccattagttaagcccgatgtagttacgctggatttagaaatgccg
gtactggatggtcttagtaccttaaaagagttaaacaaagtttatccggtaccggtaatc
atgctttcttctttaacaacccacggagctaaggcaactattgaggccctggaaaatggt
gcggtagattttgtaccaaaagatggggattggaataaggttgtttctgagttaaaagaa
aagataaaaatagctgtcttagctaaaaaacgtccgaaaccttttaccggagggacgctt
aaccccaaaaatgttattctcggtaaaaacggccggcaattggtggtgataggtgcttct
accggtggaccgccggccttacgagaaatcattcccaaacttccgcaaacctttccggtg
cccattgtaattatccagcatattacccgcgggtttagcaagccgctggcggaccagctg
gccagagtttcccggttaaaggtaaaggaagcggaaaaagacgagcagttgctcccggga
acggtctatgtggcccctgccggctatacttttaaaattgataaacaaggaggcagttta
acagctaaaataattgagccggtggaatacttgccggctcatttctacccctccgttgat
gaggcgatgctttcggcagcagaagtgacgggcagcaaaaccataggagttttgctaact
ggcatgggaaaggatggggcgctcgggatgaaagctatcaaagaacggggagggtatacc
attgcccaggacgaagaaacttcggtagtttacggtatgcccaaagcggcaattgatata
gggggagtttctcgggttttgcccctatcggcaattgctgaagaaattgcggccaatatc
taa

DBGET integrated database retrieval system