KEGG   Carboxydothermus hydrogenoformans: CHY_1039Help
Entry
CHY_1039          CDS       T00287                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHY_1039
   01230 Biosynthesis of amino acids
    CHY_1039
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHY_1039
   00030 Pentose phosphate pathway
    CHY_1039
   00051 Fructose and mannose metabolism
    CHY_1039
  Energy metabolism
   00680 Methane metabolism
    CHY_1039
Enzymes [BR:chy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CHY_1039
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CHY_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918562..919647
Genome map
AA seq 361 aa AA seqDB search
MGKITVTVIKADVGGFVGHSSVHEELLATAREQLAKSPLLVDFHVTHVGDDINLIMTHRQ
GVDSEEIHKLAWDTFVACTEVAKKLKLYGAGQDLLADAFSGNVKGLGPGIAEMEFFERTS
EPIIVFAADKTEPGAWNLPLYKMFADPFNTIGLVIDPKMHEGFKFEVLDLLENKKIIFNT
PEDLYDLLVFIGAPGRYCVKSVYTKAGEIAATSSTQRLNLMAGRYIGKDDPVLIVRCQSG
LPAVGEALEPFARPHLVSGWMRGSHSGPLMPVSVADATPSRFDGPPRVIALGFQLADGKL
IGPQDFFADKAYDRAREMALMIADYMRSLGPFEPHRLHLEEMEYTTLPLVLEKLKDRFVK
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagataacggttaccgtcattaaagcggatgtaggagggttcgttgggcactcc
agtgtgcatgaagagcttctggccactgcccgggaacagctggcgaaaagccctcttctg
gtggattttcatgtaacccacgttggtgacgacatcaatttaatcatgacccaccgtcag
ggggtggattcggaggaaatccacaagttagcctgggatacttttgtagcctgcacggaa
gtggccaaaaagttaaaactttacggagcaggacaggatctactggcggatgctttttcc
ggtaacgtcaaaggtctgggtccgggaattgcggaaatggagttttttgagcgaaccagc
gaaccgattatcgtttttgccgcagacaaaacggaacccggagcctggaacttgccgctg
tataaaatgtttgccgacccgtttaacaccattgggcttgtcattgatcccaaaatgcac
gaaggctttaaatttgaagttttagacctcctggaaaataaaaagattatcttcaatact
ccagaagatttatatgaccttctcgtatttatcggtgctcccggccgctattgtgtcaag
agtgtttataccaaagccggggaaattgccgctacctccagtacccagcgcttaaacctc
atggccggccggtacatcggtaaggacgacccggtgttaatcgtccgctgccaaagcggt
ttaccggcggtgggcgaagctttagagccctttgcccggccgcacctggtttccggctgg
atgcgcggttcccattccggaccgttaatgccggtgtcggtggccgatgctactccgtcc
cgctttgacgggccgccccgggtaattgcccttggcttccagctggccgatggaaaactc
attggtcctcaggatttctttgccgataaagcttatgaccgggcgcgggagatggcctta
atgattgccgattacatgcgaagcctcggcccctttgaaccccaccggctccatttagag
gaaatggagtataccacgttgccgctggtcttggaaaagctaaaagatcgctttgtaaaa
gcataa

DBGET integrated database retrieval system