KEGG   Carboxydothermus hydrogenoformans: CHY_1279Help
Entry
CHY_1279          CDS       T00287                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CHY_1279 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHY_1279 (mhpF)
   00650 Butanoate metabolism
    CHY_1279 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CHY_1279 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CHY_1279 (mhpF)
   00622 Xylene degradation
    CHY_1279 (mhpF)
   00621 Dioxin degradation
    CHY_1279 (mhpF)
Enzymes [BR:chy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CHY_1279 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1139150..1140049
Genome map
AA seq 299 aa AA seqDB search
MSNKIKAAIIGPGNIGMDLMFKLMRSKYIDVDTVVGIIPESEGLALARKHGKKTSAEGIK
AILGNKDIKIVFDATSAKAHLKHAPLLEQDGKIAIDLTPAAVGPYCVPAVTMEEQLNCKN
VNMVTCAGQATTPIVYAINKIADVKYAEIVATISSRSAGPGTRQNIDEFTETTAKALEKI
GGADKGKAIIILNPAEPPIMMRNTIYTRVANPDAPGIIEAIEEMVGKIKKYVPGYRLKVP
PIIDGDKITTIIEVEGEGAYLPKYAGNLDIITAAAVAFADEVAKKLLAEEQAKEVRAHG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaaaattaaagctgccattatcggtcctggcaatatcgggatggatttaatg
tttaaattaatgagaagtaaatatattgatgttgacacagttgttggcattattccggaa
tcggaaggattggcattggctagaaagcatggaaagaagactagtgctgaaggaataaaa
gcaattttaggaaataaggatattaaaatcgtttttgatgctaccagtgccaaagctcat
ttaaaacacgctcctttattagaacaagatggtaaaattgctatcgacctgacacctgca
gcagttggtccttattgtgttcctgcagtaactatggaggaacaattaaattgcaaaaat
gttaatatggttacttgtgccggacaagctactactccaattgtttatgcaattaacaaa
attgccgatgtaaaatatgctgaaatagtagctacaataagtagccggagtgctggtcca
ggaacgcggcagaatattgacgaatttaccgaaactacggcaaaagccctggaaaaaatt
ggcggggccgataaaggaaaagcaataattattcttaacccggctgaaccgccaattatg
atgcgaaacactatttacacccgggtagcaaatccggatgctcctggaattatcgaggca
attgaagaaatggtggggaagatcaaaaaatacgttcctggttatcgcttgaaagttcct
ccaatcattgatggagataagattaccacaataattgaagttgaaggtgagggggcctat
ttgcctaaatatgccggtaatcttgatataatcaccgcagcagcagtagcttttgctgat
gaagtagctaaaaagttgctggctgaggagcaagctaaggaggttagagcacatggctaa

DBGET integrated database retrieval system