KEGG   Carboxydothermus hydrogenoformans: CHY_1329Help
Entry
CHY_1329          CDS       T00287                                 

Gene name
aor2
Definition
tungsten-containing aldehyde ferredoxin oxidoreductase (EC:1.2.7.-)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHY_1329 (aor2)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CHY_1329 (aor2)
Enzymes [BR:chy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CHY_1329 (aor2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1188182..1189951
Genome map
AA seq 589 aa AA seqDB search
MQGFYGKILRINLTDKSYRVEELSEEILKKYLGGKGLGSYLLLNNVAPRIDPLSPDNKLI
FTAGPATGTGMLGSSRYGVFSKSPLTGLYAESYSGGKVAPAMRKTGYDAIILEGASSEPV
YLEISDSTVKFHDATHLWGKDTYYTENKVLEEVGVPGAQAVVIGPAGENLVLFACIENNY
WRSAGRTGLGAVMGSKKVKAVVFHGQAQGEIADPELLKSLIKSISQKAKDNPGVKAYQMY
GTTQMVRIMNGAKAFPTKYWSNGTYEHWEDISGDSLITNFEVKPRSCPNCFLACGKLTTV
KEGKYAGLTVEGPEYETIYAFGGLCCINRLDEILKLNDICDRLGMDTITAGNLAAFAIEA
VNRGKIKADLQYGNADGIARLLEDIAYGRGIGAILARGIKKASEEWEMEDVAIHVKGLEP
AGYDPRVLKGMGLAYATSTRGACHLRATFYKAELSGMIDPATIEGKARLFIEFENRLTIF
NTQILCVFFRDLIQWPELIQLIKATTGWEYTQQELEEMANRIVTLTRVFNSREGATKAQD
TLPKRFFSEPINEGKNSISEEELSYMVNEYYRLRGWDDQGFPTSEPCFF
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtttttatgggaaaatactaaggattaaccttaccgataagtcttaccgtgtg
gaagaactcagtgaagagatattgaaaaaatatttaggcgggaaagggttggggtcatat
cttctccttaacaatgtcgctccaaggatcgatcccctttctccggataataagcttatt
tttactgcaggtccggctactggaacaggaatgttaggttccagccgttatggcgtattt
agcaaatcgcccttaacaggtttatatgctgaatcatattccggaggaaaagtagctcct
gccatgcgaaaaacgggctatgatgcgattattctggaaggagcttcttctgagccagtg
tatttagaaataagtgatagtactgtaaagttccacgatgccacccatctttggggcaaa
gacacctattatactgaaaataaagttcttgaagaagtaggcgttcctggggctcaagcg
gtggtcattggaccggcaggtgaaaatttagtactttttgcctgtattgaaaacaactac
tggcgctcggcaggacgtaccggcctgggtgcggtgatgggttccaaaaaagtcaaggct
gtagtttttcatggtcaggcccaaggtgaaattgccgatcctgagttattgaaaagcttg
attaaatccattagccagaaagctaaagataatccgggagttaaggcttatcaaatgtat
ggtactacccagatggttagaataatgaacggagctaaagcctttccaacgaaatactgg
tctaatggtacctatgagcactgggaagatatcagtggagatagtttaatcaccaatttt
gaggtcaagcccaggagctgtcccaattgttttctggcttgtggcaaactgactaccgtg
aaagaagggaagtacgcgggtttaacggtagaggggccggagtatgaaaccatttatgcc
tttggcggtttatgctgcattaaccgattggatgaaattttaaaattaaatgacatatgc
gatcggttgggcatggataccatcaccgctggtaatttagctgcctttgctattgaagcg
gttaatagagggaagataaaggcagatttacaatatggaaatgctgatggcattgcccga
ctattggaagatattgcttatggcaggggcattggggcgatcctggctcggggtattaaa
aaagcttcagaggagtgggaaatggaagatgtggcaatccatgtaaagggcttagagccg
gcaggatatgatcctcgagtccttaaagggatgggtttagcctatgcaacttcaacaaga
ggtgcctgtcatttgagagctacattttataaagctgaactaagcgggatgattgacccg
gcaacaatagagggcaaagccagattgtttatagagtttgaaaatcgcctaacgatattt
aatacccaaattttgtgcgtatttttccgggatttaatccagtggccggagcttattcaa
ctaattaaggcaactaccggctgggaatacacccagcaggaattagaagaaatggccaat
aggattgtcactttaaccagggtgtttaacagccgggaaggggcaacaaaagctcaggat
acgttgccaaaacgtttcttttcggaaccgatcaatgaaggcaaaaatagtatttccgag
gaagaactatcttatatggtaaatgagtactaccgtttgcggggatgggatgaccaagga
tttccaacctcagagccatgtttcttttaa

DBGET integrated database retrieval system