KEGG   Carboxydothermus hydrogenoformans: CHY_1349Help
Entry
CHY_1349          CDS       T00287                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHY_1349
   01230 Biosynthesis of amino acids
    CHY_1349
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHY_1349
   00030 Pentose phosphate pathway
    CHY_1349
   00051 Fructose and mannose metabolism
    CHY_1349
   00052 Galactose metabolism
    CHY_1349
  Energy metabolism
   00680 Methane metabolism
    CHY_1349
Enzymes [BR:chy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CHY_1349
Protein phosphatases and associated proteins [BR:chy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHY_1349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1207920..1209005
Genome map
AA seq 361 aa AA seqDB search
MAVGILTGGGDCPGLNAVIRALVKTLQQKLPEEKIIGFLDGFRGAIENRSVPLTTKDVVG
LLPKGGTILGTSNRDNPFKFPVSVNGTLEFHDVSDTVIENLHKNNIEVLFVIGGDGSLSI
AHELSQKGVKVIGIPKTIDNDLDATDFTFGFDSAVRTATKALDMLHTTAESHHRIMVLEV
MGRYAGWIALYSGLAGGADVILIPEIPFNWDAVCRKIQQRKAEGKHFSIVVVAEGAYPEG
GERVIARYVKESTDPARLGGIGQVVADHLSRCTGLESRVTVLGHLQRGGGPTPFDRILAT
RFGVAAVNTWLQGNYNVMVAFLGGRVTTVPLSEGIKKLKLVPVDSELIVTAKAIGISFGD
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgggtattttaaccggtggtggtgattgcccgggcttaaatgcagtaattcgg
gctttagtgaaaactcttcaacaaaagcttcccgaagagaaaataatcggctttttagat
ggttttcgcggggcaattgaaaaccgaagtgtgcctctaacaacgaaagacgtggtaggt
ttactccctaaaggcggaacgattttgggcacttccaaccgggataatccttttaaattt
cccgtatctgttaacggcaccttagaatttcacgatgttagcgatactgtaatcgaaaat
ttacataaaaacaatattgaggtgttattcgtcattgggggtgatggttctctttctatt
gcccacgaactctcccaaaagggtgtaaaggttataggaatcccaaaaactatagataat
gacctggatgctaccgattttacctttggctttgacagtgcggtaaggaccgcaaccaaa
gctcttgatatgcttcacaccactgctgaatcccaccaccggatcatggtattggaggtt
atgggacggtatgccggctggattgccctatattcgggactggccggaggtgcagatgtt
attttaattcccgaaattccctttaactgggatgccgtttgccgaaaaattcagcaaaga
aaagccgaaggaaagcatttttccatagttgtagttgctgaaggagcctatcccgaaggt
ggggaaagggtaattgcaagatatgttaaggaaagtaccgatccggcccgtttgggggga
attggccaggtagtagctgaccatttaagccgctgtacgggcttggaaagcagggtaacg
gttttaggtcacctgcaaaggggtggaggtcctacaccctttgaccgcatcctggcgact
cgctttggggttgctgcagtaaatacatggcttcagggtaattataatgtcatggttgcc
tttttagggggaagggtaactacggtgcctttaagcgaaggaataaaaaaattaaaatta
gtccccgttgattcagaattaattgtaaccgctaaagcaataggtataagttttggagat
gaatga

DBGET integrated database retrieval system