KEGG   Carboxydothermus hydrogenoformans: CHY_1371Help
Entry
CHY_1371          CDS       T00287                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHY_1371
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHY_1371
   00650 Butanoate metabolism
    CHY_1371
  Energy metabolism
   00190 Oxidative phosphorylation
    CHY_1371
   00720 Carbon fixation pathways in prokaryotes
    CHY_1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1229494..1229838)
Genome map
AA seq 114 aa AA seqDB search
MSESKLWFLFIVAALILLVFLGIHLGYMHLDNILGVNDPLDYNNVKTRGQDTFWLVSYLI
LLVAALYHGMYGLRTILLEYFPQNLKFINGLIGIIGFLALVLGSYVVIYSYIGG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaatcaaaattgtggtttttattcatagtagctgctttaattttactggtgttt
cttggaatacatctgggatacatgcatcttgataatattttgggcgtaaacgaccccttg
gattacaataacgtaaaaacccggggacaggataccttttggctggtgagttatcttatc
cttttagtagctgctttatatcacggaatgtatggcttaagaacgattcttttggaatat
tttccgcaaaatcttaaatttattaatggtttaatagggataattggctttttagcttta
gttttaggtagttatgttgtaatatattcttacattggggggtag

DBGET integrated database retrieval system