KEGG   Carboxydothermus hydrogenoformans: CHY_1450Help
Entry
CHY_1450          CDS       T00287                                 

Gene name
fabH
Definition
3-oxoacyl-ACP synthase (EC:2.3.1.41)
Orthology
K00648  
3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:chy01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:chy00061]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1298352..1299344)
Genome map
AA seq 330 aa AA seqDB search
MSGRIEGIEILGTGYYVPEKVLTNKELESRLDTTDEWIVTRTGIRERRIASPEETTLSMA
YYASEKAIQKAKIEPGEIGLIIVATATPDMIFPATAAQLQEKIGATNAGAFDLSIGCTGF
IYALVTGALYTKVLYPQKVLVVGAEKLSAIVDWQDRSTAVLFGDGAGAVILGVNPQKAGI
LAFELGADGSGAELLKLPAGGSKLPASAETVEKRLHFIKMNGSEVFKFAVKKIEESVNGL
LEKAKLQPDDIDLYLFHQANRRIIVNSLERLALDIEKTFINIELYGNTSAASIPIALDEA
IHAGKLKKGDKLLLSGFGAGLAWGGLIMEY
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaggattgaaggcattgaaattttaggaacagggtattatgtgccagaaaag
gttttaacgaacaaagagcttgagtcaagattggatactaccgatgaatggatagtaacc
cgaactggaatcagggaaaggcgtattgcctccccggaagaaactaccctatcaatggca
tactatgcttcagaaaaggcaatacagaaggcaaaaatcgaaccaggggaaattggttta
ataattgtggctaccgctactccggatatgatttttcccgcaacggcggcccagttgcag
gaaaagattggggctaccaatgccggggcttttgatttgtctattggttgcactgggttt
atttatgctttagttaccggagctttatatactaaagtgctgtatccccaaaaggtactt
gtagtgggcgctgaaaagctttcagcaatagttgactggcaggatagaagtaccgctgtt
ttatttggtgatggtgcaggtgctgtgatattgggtgtaaatcctcaaaaagcggggatt
ttggcctttgaacttggagccgacggaagtggtgctgagctattaaaattgcctgctggt
gggtctaaacttccagcatcagcagaaactgtcgaaaaaaggctccattttattaaaatg
aatggaagtgaagtttttaaatttgctgtaaagaaaattgaagagtcggtaaacggttta
cttgaaaaagccaaattacaaccggacgatattgatttatatttatttcaccaagccaat
cgtcgaataattgttaactctttggaacgtttagctttagatattgaaaagacctttatt
aatatcgagctttacggaaatacctcggcggcgtctataccaatagcattggatgaagct
attcatgcgggaaaactaaagaaaggtgataagctcttactcagtggttttggagcgggg
cttgcctggggcggtttaattatggaatattag

DBGET integrated database retrieval system