KEGG   Carboxydothermus hydrogenoformans: CHY_1581Help
Entry
CHY_1581          CDS       T00287                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHY_1581 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHY_1581 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHY_1581 (trpA)
Enzymes [BR:chy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHY_1581 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1421826..1422629)
Genome map
AA seq 267 aa AA seqDB search
MSRIGQVFAEKRSRGEKALIAYTMGGDPNLTFSLEIIKTLAAAGADLIEVGLPFSDPLAD
GPVIQRAGQRALAAGSGPEEVLALIAAARQELSLPLVIMSYLNPILQIGVDEFLRRAAGA
GADGLIIPDLPVEEGEEIRVSAAGYGLDLIPLVAPTTGQKRLEKIVGQASGFIYCVSVTG
VTGARDSLPAEVISLLQNVKKLTELPVCLGFGIGKPEQIAYIKDYCDGVIVGSALVEIIE
NYVQNRMEKDKVLELIATKVQTLKSVS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaggattggtcaagtatttgcggaaaaacggagtcgaggggaaaaagcccttatt
gcctatacgatgggaggagacccaaatcttactttttctctggaaattatcaaaaccctg
gcggcggctggagccgaccttattgaagtgggcttacctttttctgaccctttagccgat
ggaccggtgattcagagagccgggcagcgggctctggctgccggtagcggtccggaagaa
gtactggcactgatagcggctgcccgccaggagctatctttgccgctggtcattatgtcc
tacctcaatccgattctccaaataggtgtagacgagtttttgcggcgggcagcgggggct
ggagctgatggtctgataattcccgaccttccggtggaagaaggagaagaaataagggtg
tcggccgcgggatacggccttgacttaattcctttggttgctcccacaaccgggcaaaag
cggcttgaaaagattgtgggtcaagcttcaggatttatttattgtgtgtctgtaaccggg
gtcacgggggcacgggatagtttgccagcagaggttatatctttattgcaaaacgtaaaa
aagttaaccgagttacccgtttgtttaggatttgggattgggaaaccagagcagatagca
tacattaaagattactgcgatggtgtaattgtgggaagtgcattagtagagattattgaa
aactatgttcaaaataggatggagaaagataaggttttagaattaatagccacaaaagta
caaacattaaaatcagtttcataa

DBGET integrated database retrieval system