KEGG   Carboxydothermus hydrogenoformans: CHY_1582Help
Entry
CHY_1582          CDS       T00287                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00260  Glycine, serine and threonine metabolism
chy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chy01100  Metabolic pathways
chy01110  Biosynthesis of secondary metabolites
chy01130  Biosynthesis of antibiotics
chy01230  Biosynthesis of amino acids
Module
chy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHY_1582 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHY_1582 (trpB)
Enzymes [BR:chy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHY_1582 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ABB15832
UniProt: Q3ABS3
Position
complement(1422622..1423830)
Genome map
AA seq 402 aa AA seqDB search
MSLKNYKLPDARGYFGPYGGQFVPETLMAALEELIEAYEEVKNDRSFQAELTFYLQHYAG
RPTPLYFAESLSRYVGGAKIYLKREDLAHTGAHKINNTIGQVLLARRMGKKKVVAETGAG
QHGVATATAAAKFGLECTIFMGAEDVRRQELNVYRMRLLGAQVESVTSGSRTLKDAMNEA
IRYWVTHVRDTYYVLGSVGGPHPYPTIVRDFQKVIGEETKAQILAQEGRLPDLIVACVGG
GSNAIGMFYPFLEEDVRLVGVEAAGLGLESGRHAATLSRGKVGVLHGAKSYVLQDDRGQI
VEAHSISAGLDYPGVGPEHAYLKDIGRVEYTAVTDEEALEAFKLLAKTEGILPALESAHA
VAKGVELARELESEKIVVINLSGRGDKDVYTVARELGVTLGE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaaaaaactataaattgccagatgcacgagggtattttggcccctacggtggg
cagtttgtaccagaaactttaatggcagctttagaagagctgatagaggcttacgaggaa
gttaaaaatgatcgttcatttcaagctgaattaaccttttatttgcaacattatgccgga
cgtcctacgcctctttattttgctgagagcctgtcccggtatgtaggaggggcaaagatt
tatctaaaacgggaagaccttgcccataccggtgcccacaaaattaacaataccataggg
caggttctgctggcgcggcgcatgggcaaaaaaaaggtagtggcggaaaccggggccggc
cagcatggagtagctaccgctacggcggcggcaaagtttggattggagtgtactattttt
atgggggcagaggatgtccgccggcaggaattgaatgtgtaccgcatgcgccttttaggt
gcgcaagtggaaagtgtaacttccggtagtcgtactcttaaagatgctatgaatgaggcc
attcgctactgggttactcatgttcgggatacttactatgtccttggttcggttggcgga
ccacatccctatcccacgattgttcgggattttcaaaaggtgatcggggaggaaaccaaa
gcgcaaatcttagcgcaggaaggaagactccctgacttaattgtagcgtgtgttggtggg
ggaagtaatgctatagggatgttttatccttttcttgaagaggatgtgcggttagttgga
gtagaagcggccggattagggctggaaagcgggcggcatgctgctaccttaagccggggt
aaggtgggagttttacacggagctaaatcttatgttttacaggatgatcgaggccaaatt
gtagaggctcattccatttcggcaggattggactaccccggggtaggaccggaacatgcg
taccttaaagatattggtagagtggagtatacagcagttaccgatgaagaagctttagaa
gcattcaaacttctggcgaaaacggagggtattctgccggctctggaaagcgcccatgct
gtggccaagggagtggagcttgcccgggagcttgagtcagaaaaaatagtagtaatcaac
ctttccggccgtggtgataaggatgtctacaccgtggcccgcgaattgggggtgaccctt
ggtgagtag

DBGET integrated database retrieval system