KEGG   Carboxydothermus hydrogenoformans: CHY_1620Help
Entry
CHY_1620          CDS       T00287                                 

Definition
(GenBank) putative agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00330  Arginine and proline metabolism
chy01100  Metabolic pathways
Module
chy_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CHY_1620
Enzymes [BR:chy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CHY_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABB14696
UniProt: Q3ABP1
Position
complement(1456230..1457093)
Genome map
AA seq 287 aa AA seqDB search
MLPVEKFTGFMGSSDNYEGAAFVLFGIPMDFTVSFRPGARMAPQHIRQVSFGLEEYDWDL
EKSLNDVNFYDMGDVALTLGRIEESFTSIRTVTKKVLSDGKIPLIIGGEHLITYPVILEF
AEKYPDLAVVHFDAHADLRDHYQGEKLSHATVMRRVAEIIGPQNIYHIGIRSGTQEEKEF
ITKKSNYLGQNVLAGVEKALEKLGQKPVFISLDIDVVDPAFAPGTGTPEPGGATSIEIME
AIVKLSSLNIVGMDLVEVLPVYDPSERTSLLAAKILRRALLSFNITR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctgttgaaaaatttactggttttatgggcagttccgacaattatgaaggtgct
gcctttgttttatttggtattcctatggattttaccgtcagttttcggccaggtgcccgc
atggctccccagcatatccgtcaggtttcctttggtttagaggagtatgactgggatttg
gaaaaaagtcttaatgacgtaaacttttacgatatgggagatgtagcgcttactttgggc
aggattgaagaaagctttaccagcatccggacagtaacgaaaaaagtgttgagtgacggt
aaaattccgctaattatcggtggcgaacatttaattacttatccggtgatcctggaattt
gccgaaaagtatcccgatttagctgtagttcactttgacgctcatgcggatttgcgggat
cattatcagggagaaaaactttcccatgcaacggttatgcggcgtgtagcggaaattatt
gggccgcaaaacatttatcatatcggtatccgttccggtacccaagaggaaaaggagttt
attacaaaaaaatcaaactatcttggccaaaacgtattggcgggcgtagaaaaagcgttg
gaaaaacttgggcaaaagccggtgtttatttccctggatattgatgtggtagatccggcc
tttgccccgggaaccggaaccccggaaccggggggagctaccagcattgagataatggaa
gccattgtaaaacttagttctttaaatattgttggcatggatttagttgaagtattgccc
gtctatgatccttcggaacgtacatcgctcttggcggccaaaattttgcgccgggcattg
ttatcttttaatattaccaggtaa

DBGET integrated database retrieval system