KEGG   Carboxydothermus hydrogenoformans: CHY_1649Help
Entry
CHY_1649          CDS       T00287                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:chy03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1479593..1480384)
Genome map
AA seq 263 aa AA seqDB search
MPELPEVETIKRTLAPKILGKTIYRVEVYLPKIIKNVSVEEFTRRVVGKEIVALKRRGKY
LLIDLSGKETVTVHLRMTGKLLILPKGSPKDKHTHAIFDLGDLELHFNDIRQFGGFSFEM
PEIGPEPLEDEFTPEYLKTKLKASQKNLKAVLLDQKIIAGIGNIYADEILFEAGLSPKRI
AASLSEDEAEELFKAIRKILALGIEYRGTSIRDYVDAENQQGSFQRLLKVYGKNGSLCVR
CNNVLIRERHAGRSTHYCPHCQK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacttccagaagtagaaaccattaaaagaacccttgccccaaaaattttggga
aaaacaatttaccgggtagaagtatatcttccaaaaattattaaaaatgtttcggtagaa
gaatttacccggcgcgttgtggggaaagaaatagtagctttaaaacgccgggggaagtat
ttactgatagatctttccggaaaggaaacggtaacggttcatttgaggatgaccgggaaa
cttttaatactacccaaagggtcgccgaaagataaacatacccatgctatttttgatctt
ggcgatttagagttacattttaatgatatacgccagtttggtggcttttcttttgagatg
ccggaaataggtcctgaacctttagaagacgagtttacccctgagtatttaaaaacaaaa
ctaaaggcgtcacagaaaaatcttaaggccgttttattagaccaaaaaataattgcgggt
attggtaatatttacgctgatgaaatcttatttgaggcagggctttctcccaaaaggata
gccgccagcttatcggaagatgaggcagaagagttatttaaagctatacggaaaatctta
gccctggggattgagtaccgggggacgtctattagagattatgttgatgcggaaaatcag
caggggagctttcaacgcctgctaaaagtttacgggaaaaatggttcactctgtgttaga
tgtaataatgtcctaatccgcgaacgtcacgccggtcgcagtacccactactgtccgcac
tgccagaaataa

DBGET integrated database retrieval system