KEGG   Carboxydothermus hydrogenoformans: CHY_1815Help
Entry
CHY_1815          CDS       T00287                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:chy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CHY_1815
Enzymes [BR:chy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CHY_1815
DNA repair and recombination proteins [BR:chy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CHY_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 UvrD_C HHH_5 HHH_2 Helicase_RecD AAA_22 5_3_exonuc HHH AAA_12 PIF1 T2SSE DUF2075 DNA_pol_lambd_f HTH_IclR NTPase_1 AAA_28 ABC_tran AAA ResIII Mg_chelatase AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: ABB15867
UniProt: Q3AB49
Position
complement(1626329..1628566)
Genome map
AA seq 745 aa AA seqDB search
MTRNFLLEETINVEVKYIKFSRENFIIAGAKILEGERQGEIIDILGEIINCRVGERYRVS
GKFVNNPNYGLQFQVKYYERERPNSPEQLISYLSNLGVKGIGEKTAAKIVERFGMDSLTV
ILKDFSQLTKIRGISFEKAESLYQKLKEEYLFEEAFNLLAPLNLEPHQIKTLLKFYRESL
IEHLKENPYKPIHELYGFAFAPFDKLAKDWHFPPNHLYRIKASIVYVLKEALEQGHVYLP
LAEVYNKGLALLGEGIGPETLDEGLSVLLRTGEVCLERDRLYLKKLYDAEKTVARKVAFL
LTITDKKINIKKPLNEVEKKLGISYDPLQKEALSLMFAEKKLFILTGGPGTGKTTVIKGF
IELYQRFFPKNKIALAAPTGRAAKRLSESTGMPAATIHRLLEPEGETRSGELLFRYNKYE
PLPYDLIIIDEVSMLDLPLAAALFEAITPECRLVLVGDPNQLPPVGPGQLLKDLLAVEEI
PRISLKTVFRQGEDAGIIEVAHRVLTGDWSELERLLGRRILEDVFFLPAKDTENITNLLL
KVVKKLWENYGYSPEDIAVLSPMRKGALGVENLNVLLQKLFNGFETQEVKFFGTSFKVND
KVMQIKNNYERGEDGVFNGETGFIKKIIKSGDEEEIIVSFDGKNIKYRKTDLEELTLSYA
TTVHKAQGMEYPVVILVLHNYHYPLLKRNLLYTAVTRAKKMLIVIGTPWALRQAVENIKE
ETRYSSLPERLGGVFEKGDLVEREG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaattttcttttggaagagacaattaatgtagaagtaaaatatataaaattc
tcccgggaaaactttattattgccggagctaaaattttagaaggagaacggcagggggaa
attattgatattttaggggaaataattaactgccgggtaggcgaacggtaccgggtttcg
ggaaagtttgtcaataaccccaattacggtttgcagtttcaggttaaatactacgaaagg
gaaagaccaaattctccggaacagttaatctcgtacctgtctaacttaggggttaaggga
attggggaaaaaacggcagcgaaaattgttgaaagatttggtatggactccctgaccgtt
atcctaaaagatttttcccagctaacaaaaataagaggcatttcctttgaaaaagcggaa
agcctgtaccagaaattaaaagaagagtatcttttcgaagaagcttttaatttattagct
ccgctaaacttggaaccgcatcaaattaaaaccctgctcaaattttaccgggaaagttta
atagagcacttaaaagagaatccttacaaacccattcatgaactttacggttttgccttt
gcaccctttgataagctggcaaaagattggcattttcccccgaaccacctttaccggatt
aaagcttctatcgtttatgtgttaaaggaagctctggagcagggacatgtttatttacct
ttggcagaagtgtataacaaagggctggctcttctgggggaagggattgggcctgagacc
ctcgacgaggggctttccgtacttttaagaaccggagaagtgtgcctggaaagggaccgg
ctttatttgaaaaagctttatgatgcggaaaaaacggtggcgcggaaagtagcctttctt
ttaacgattaccgataaaaaaattaatataaagaagcctctgaacgaggtagaaaaaaaa
ctgggaatttcctacgacccattacaaaaggaagctctatcgttaatgtttgccgagaaa
aaactttttattttaaccgggggtcctggtaccggtaaaaccacggtaatcaaaggattt
attgagctgtatcagaggttttttcctaaaaacaaaattgctctggcggcgcctaccggg
cgcgcggcgaaaaggctttccgaaagcaccgggatgccggcggcgacaattcaccgtctt
ttagaaccggagggggaaacccgttcgggagaactgctttttcgctataacaaatacgaa
cctttaccctacgatttaataataattgatgaagtttccatgcttgatttacctttagct
gctgctttatttgaggctataacccctgaatgccggctggtactggtgggagatcccaat
cagttgcccccggtgggtcccgggcaattgttgaaagatcttttagccgtggaagaaatt
ccgcggataagcctgaaaacggtttttcgtcagggagaagatgcaggaattattgaggtt
gcccaccgggtattaaccggggattggtctgaacttgagcggctccttgggagaagaata
ttggaggatgtgttttttcttccggcgaaagatacggaaaatattactaatcttctttta
aaggtggttaaaaagctctgggaaaattacgggtattctccggaagatattgccgtttta
tctcctatgcggaagggcgctttaggggtagaaaatttaaatgttttactgcaaaaactg
tttaacggttttgaaacacaggaagtaaaatttttcggtacttcttttaaagtgaacgat
aaggtcatgcagataaaaaataattacgaacggggagaagatggggtatttaacggcgaa
accgggtttatcaaaaaaattattaaatccggggatgaagaagaaatcattgtttctttt
gacggcaaaaacataaaatatcggaaaacggatttagaagagctgacgttgtcttatgcg
actaccgttcataaagctcagggaatggaatatccggtggttattcttgttttacataat
taccattatcctttacttaagagaaatcttctttatactgctgtaaccagggccaagaaa
atgcttattgtcataggaactccctgggctttacggcaggcggtggaaaatattaaggaa
gaaaccaggtattcttctttgccggaaagactcgggggagtttttgaaaagggtgatctg
gttgagcgggaaggttaa

DBGET integrated database retrieval system