KEGG   Carboxydothermus hydrogenoformans: CHY_1815Help
Entry
CHY_1815          CDS       T00287                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:chy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CHY_1815
Enzymes [BR:chy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CHY_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1626329..1628566)
Genome map
AA seq 745 aa AA seqDB search
MTRNFLLEETINVEVKYIKFSRENFIIAGAKILEGERQGEIIDILGEIINCRVGERYRVS
GKFVNNPNYGLQFQVKYYERERPNSPEQLISYLSNLGVKGIGEKTAAKIVERFGMDSLTV
ILKDFSQLTKIRGISFEKAESLYQKLKEEYLFEEAFNLLAPLNLEPHQIKTLLKFYRESL
IEHLKENPYKPIHELYGFAFAPFDKLAKDWHFPPNHLYRIKASIVYVLKEALEQGHVYLP
LAEVYNKGLALLGEGIGPETLDEGLSVLLRTGEVCLERDRLYLKKLYDAEKTVARKVAFL
LTITDKKINIKKPLNEVEKKLGISYDPLQKEALSLMFAEKKLFILTGGPGTGKTTVIKGF
IELYQRFFPKNKIALAAPTGRAAKRLSESTGMPAATIHRLLEPEGETRSGELLFRYNKYE
PLPYDLIIIDEVSMLDLPLAAALFEAITPECRLVLVGDPNQLPPVGPGQLLKDLLAVEEI
PRISLKTVFRQGEDAGIIEVAHRVLTGDWSELERLLGRRILEDVFFLPAKDTENITNLLL
KVVKKLWENYGYSPEDIAVLSPMRKGALGVENLNVLLQKLFNGFETQEVKFFGTSFKVND
KVMQIKNNYERGEDGVFNGETGFIKKIIKSGDEEEIIVSFDGKNIKYRKTDLEELTLSYA
TTVHKAQGMEYPVVILVLHNYHYPLLKRNLLYTAVTRAKKMLIVIGTPWALRQAVENIKE
ETRYSSLPERLGGVFEKGDLVEREG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaattttcttttggaagagacaattaatgtagaagtaaaatatataaaattc
tcccgggaaaactttattattgccggagctaaaattttagaaggagaacggcagggggaa
attattgatattttaggggaaataattaactgccgggtaggcgaacggtaccgggtttcg
ggaaagtttgtcaataaccccaattacggtttgcagtttcaggttaaatactacgaaagg
gaaagaccaaattctccggaacagttaatctcgtacctgtctaacttaggggttaaggga
attggggaaaaaacggcagcgaaaattgttgaaagatttggtatggactccctgaccgtt
atcctaaaagatttttcccagctaacaaaaataagaggcatttcctttgaaaaagcggaa
agcctgtaccagaaattaaaagaagagtatcttttcgaagaagcttttaatttattagct
ccgctaaacttggaaccgcatcaaattaaaaccctgctcaaattttaccgggaaagttta
atagagcacttaaaagagaatccttacaaacccattcatgaactttacggttttgccttt
gcaccctttgataagctggcaaaagattggcattttcccccgaaccacctttaccggatt
aaagcttctatcgtttatgtgttaaaggaagctctggagcagggacatgtttatttacct
ttggcagaagtgtataacaaagggctggctcttctgggggaagggattgggcctgagacc
ctcgacgaggggctttccgtacttttaagaaccggagaagtgtgcctggaaagggaccgg
ctttatttgaaaaagctttatgatgcggaaaaaacggtggcgcggaaagtagcctttctt
ttaacgattaccgataaaaaaattaatataaagaagcctctgaacgaggtagaaaaaaaa
ctgggaatttcctacgacccattacaaaaggaagctctatcgttaatgtttgccgagaaa
aaactttttattttaaccgggggtcctggtaccggtaaaaccacggtaatcaaaggattt
attgagctgtatcagaggttttttcctaaaaacaaaattgctctggcggcgcctaccggg
cgcgcggcgaaaaggctttccgaaagcaccgggatgccggcggcgacaattcaccgtctt
ttagaaccggagggggaaacccgttcgggagaactgctttttcgctataacaaatacgaa
cctttaccctacgatttaataataattgatgaagtttccatgcttgatttacctttagct
gctgctttatttgaggctataacccctgaatgccggctggtactggtgggagatcccaat
cagttgcccccggtgggtcccgggcaattgttgaaagatcttttagccgtggaagaaatt
ccgcggataagcctgaaaacggtttttcgtcagggagaagatgcaggaattattgaggtt
gcccaccgggtattaaccggggattggtctgaacttgagcggctccttgggagaagaata
ttggaggatgtgttttttcttccggcgaaagatacggaaaatattactaatcttctttta
aaggtggttaaaaagctctgggaaaattacgggtattctccggaagatattgccgtttta
tctcctatgcggaagggcgctttaggggtagaaaatttaaatgttttactgcaaaaactg
tttaacggttttgaaacacaggaagtaaaatttttcggtacttcttttaaagtgaacgat
aaggtcatgcagataaaaaataattacgaacggggagaagatggggtatttaacggcgaa
accgggtttatcaaaaaaattattaaatccggggatgaagaagaaatcattgtttctttt
gacggcaaaaacataaaatatcggaaaacggatttagaagagctgacgttgtcttatgcg
actaccgttcataaagctcagggaatggaatatccggtggttattcttgttttacataat
taccattatcctttacttaagagaaatcttctttatactgctgtaaccagggccaagaaa
atgcttattgtcataggaactccctgggctttacggcaggcggtggaaaatattaaggaa
gaaaccaggtattcttctttgccggaaagactcgggggagtttttgaaaagggtgatctg
gttgagcgggaaggttaa

DBGET integrated database retrieval system