KEGG   Carboxydothermus hydrogenoformans: CHY_2407Help
Entry
CHY_2407          CDS       T00287                                 

Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:chy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2156034..2157536)
Genome map
AA seq 500 aa AA seqDB search
MPGFVYLVGAGPGDPDLITVKGLNLIKKADVIVYDRLVNPVLLTYARKDAELIYAGKAPE
RHEYLQEEINKLLVEKALAGKTVVRLKGGDPFVFGRGGEEALELTRHGIPFEVVPGITSA
IAVPAYAGIPVTHREVAASFCVITGNEDPTKKESQINWEKVALAADTLVFLMGRKNLPQI
VANLLKYGRSPQTPVAVIRLGTRAEQRTVTGCLQDIEEKVRKADLKHPVIIVVGETVKLR
EQLNWFETKRLMGKRILVTQSSNSGKLLACRLKELGAEVWHLPQVEYLKPESYREVDREL
QRLNEYKYILFTSPNGVEFFLNRLKCLELSIDALPEIIAIGEKTKKALENSGINVAHKTD
RFLPREVVKFIAGRLQDGEKILFPKSEKATILELKLREERLPVKYLPVYKAVRAKVEADH
LFELIDGRKIDFITFVSPAAVNNFFESLTDEKRERLAEIKMVSMGLSTTAEIKKYGDFEI
LEAKRPGVDGILEKILEAAI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctggttttgtgtacctcgtgggtgccggcccgggagatccggatttgattaccgtt
aaaggtttaaatctaatcaaaaaagcggatgtgatagtttacgaccgcttggtaaacccg
gtactcttaacctatgcccgaaaagatgccgaacttatctatgccggaaaagctcctgaa
cgtcacgagtatttgcaggaagagattaacaagcttttggtggaaaaagcgttagcgggg
aaaacggtggtgaggttaaaagggggagatcccttcgttttcgggcgtggtggcgaagaa
gcattggagcttacccggcacgggattccttttgaggtggttccgggaataacttcggct
attgccgttccggcgtatgcagggattccggtaacccaccgggaagtagcggcttccttt
tgcgtaataaccggtaacgaggacccgaccaaaaaagaaagtcaaattaactgggaaaaa
gtagctttagctgcggatacattggtctttttaatggggaggaaaaatctgccgcaaatt
gtagccaatttgctgaagtatggccgctcgccccaaacccctgttgccgtaatcaggctt
gggacccgagcggaacaaaggacggtaaccgggtgtcttcaggatattgaggaaaaggta
agaaaggccgacttaaagcatccggtaattattgtggtgggggagacggttaagctccgg
gagcagcttaactggtttgaaacgaaaaggctaatgggcaagcgcatactggttactcaa
agcagtaactccggtaaacttttggcttgccggttaaaagaacttggagctgaagtttgg
catttgccccaggtggaatatttaaaacccgagagctaccgggaagtagaccgggaactc
cagaggcttaatgaatacaagtatatcttatttacaagtccaaacggtgtggagtttttt
ttgaaccgtttaaagtgtttggagctatcaatagatgctttgcccgaaataattgctatc
ggagaaaaaactaagaaagctttggaaaattcagggataaatgtagcccataaaactgac
cggtttttgccccgtgaagtggtaaaattcattgccgggcgccttcaagatggggaaaaa
attctctttcccaaaagcgaaaaggctacaattttagaattaaaactccgtgaggagcgt
ttaccggtaaagtacctaccggtgtacaaggctgtcagggcaaaggttgaggcagaccat
ctttttgagttaattgatggtcggaaaattgattttattacctttgtaagcccggcagca
gtaaataatttttttgaaagcttaacggacgaaaagcgagagaggttagcggaaataaaa
atggtttcgatggggctaagcacaacggcggagattaaaaaatatggtgactttgagatt
cttgaggctaaacggcctggagttgatggcattttagaaaagatattagaagcagcaatt
taa

DBGET integrated database retrieval system