KEGG   Carboxydothermus hydrogenoformans: CHY_2582Help
Entry
CHY_2582          CDS       T00287                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00040  Pentose and glucuronate interconversions
chy00052  Galactose metabolism
chy00500  Starch and sucrose metabolism
chy00520  Amino sugar and nucleotide sugar metabolism
chy01100  Metabolic pathways
chy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CHY_2582 (galU)
   00052 Galactose metabolism
    CHY_2582 (galU)
   00500 Starch and sucrose metabolism
    CHY_2582 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CHY_2582 (galU)
Enzymes [BR:chy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CHY_2582 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ABB14042
UniProt: Q3A909
Position
complement(2299011..2299886)
Genome map
AA seq 291 aa AA seqDB search
MKIKKAIIPAAGLGVRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDILIVTGKNK
RAIEDHFDKSPELEMYLEKRGKEDLLEIVRSIGNMVDIHYVRQKEPLGLGHAIYCARKFI
GNEPFAVLLGDDLMKARTPVLKQMIDLYEKVEASIVAVQAVEPREVSKYGIIKAEEVGER
LYRVYDLVEKPKPEEAPSNLAVMGRYIIEPEIFEFLEKTPPGAGGEIQLTDALRMLCQVK
PIYGYVYEGLRYDVGDKLGFLKATVEFALDREELAQGFKAYLKELVEKEIK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaaagccattattcctgcagcgggacttggagttaggtttttgccggca
actaaagctcagcccaaggaaatgcttcctattgtagataaaccaacgattcagtacatc
gtggaagaagcggtggcgtcggggatagaggacattttaatcgttaccggtaaaaacaaa
cgggctattgaagaccattttgacaagtcgccggaattggaaatgtatctggaaaaaaga
ggaaaggaagaccttttagaaatagtccgttccatcggaaatatggtggacatccattac
gtgcggcaaaaagagcctttaggtcttggccatgctatttactgcgcccggaaatttatc
ggcaatgaaccgtttgctgttttactcggggatgacttaatgaaggccaggactccggtc
ttaaagcagatgatcgacttatacgaaaaagtggaagcgagtatcgtagcggtacaggcc
gtggagccccgggaagtaagcaagtacggaattataaaggccgaggaggtcggagagcgt
ttgtaccgggtgtatgacctggtagaaaagccaaagccggaagaagcgccctcgaacctg
gcggtaatggggcgctacataattgaaccggaaatttttgagttcctggaaaaaactccc
cccggagccggcggcgaaatacagttgaccgatgctctaagaatgctctgtcaggtgaaa
cctatatacggctatgtttatgaaggattgcgttacgatgtgggcgataaactgggcttt
ttgaaagcaactgtcgagtttgccctggaccgggaggagctggctcaaggttttaaagct
tacttaaaagaattagtggaaaaggagataaaataa

DBGET integrated database retrieval system