KEGG   Citrus clementina (mandarin orange): CICLE_v10000199mgHelp
Entry
CICLE_v10000199mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CICLE_v10000199mg
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CICLE_v10000199mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CICLE_v10000199mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 926 aa AA seqDB search
MFEGKILENGLHEEEKEPLNSSFDKVDPGKPASLTWQRKLSTEEIPLSQFTLNWKETVQL
APIGVRILCLIREEAAKGKRAFIDPFIKRHLTSSHGVPLGGVGSGSIGRSYRGEFQRWQI
FPRECEDKPVLANQFSAYLMMYVNRDTTAAGIGSWDWNLKGDKSTYHALYPRAWTVHEGE
PDPELRIVCRQISPIIPHNYKESSYPVSVFTYTIYNSGKTSADITLLFTWTNSVGGDSEF
TGQHYNSKTKTSHQLPPVTFALAAQETDGVHVSLCPHFVISGNSLGLTAKDMWHEIKEHG
SFDRLNSMETSVTSELGSSIGAAIAASVTVPPDSEGQVTFSLAWDCPEANFMSGKTYYRR
YTKFYGTHQNAAANIARDAILEHGSWELQIEAWQRPILEDKRLPEWYPITLFNELYYLNA
GGSVWTDGSPPVHSLVTIGHRKFSLDWSQSDLKRIVDVPNQNDTAVNILERMSSILEQIY
TPVALNSAFGTNLLQDGEENIGQFLYLEGIEYLMWNTYDVHFYSSFALIMLFPKIQLSIQ
RDFAAAVMMHDPSKMKLLDDGQWVSRKVLGAVPHDIGICDPWFEVNAYCLYDTARWKDLN
PKFVLQVYRDVVATGDKKFAKAVWPSVYVAMAYMDQFDRDGDGMIENDGFPDQTYDTWSV
SGISAYSGGLWVAALQAASALAREVGDRGSEDYFWFKFQKAKVVYEKLWNGSYFNYDNSG
SSQSSSIQADQLAGQWYARACGLLPIVDEDKARSALEKVYNYNVLKVMGGKRGAVNGMLP
DGRVDMSSMQSREIWSGVTYAVAASMIHEDLADIGFQTACGIYEAAWSGTGLGYAFQTPE
AWNTDDQYRSLCYMRPLAIWAMQWALTRPKPKTLEKWTKPEVTDESLLRYHAGFSKVARL
LKLPEEQGAKSLLQSLFDHTCRRMFI
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaggaaagattttggagaatggccttcatgaagaagagaaggaaccgttgaat
tcttcgtttgataaggttgacccggggaaacctgcatcacttacttggcagagaaaatta
agtactgaggaaatccctctttcacagtttacattgaattggaaggaaacggttcagttg
gctcccataggtgttcggattttgtgccttattagggaagaagctgcaaaaggaaagcgg
gctttcattgatccatttatcaagcgccatctaacatcttctcatggtgttccccttggt
ggtgttggttcaggaagcattggaagaagttatagaggtgaatttcagcgctggcaaata
ttccctagagagtgtgaagataaaccagttttagcaaatcaattttctgcttacttgatg
atgtacgtaaacagagatacaacagctgcagggattggatcttgggattggaatctgaag
ggagataagtcaacatatcatgctttatacccaagagcttggaccgtacatgagggcgaa
cctgatccagaacttagaattgtttgtcgccaaatttccccaattataccacataattat
aaggagagcagctaccctgtatcagtttttacctacacgatatataactcaggaaagact
tctgcagacatcaccttgctttttacgtggacaaattctgttggaggggattctgaattt
actggtcaacactacaattcaaaaacaaagacttcacatcagctacccccagtgactttt
gcacttgcagcacaggagactgatggtgtccatgtctcattgtgtcctcattttgtgata
tctggtaactccctaggtttaacagcaaaggacatgtggcacgaaataaaagagcatgga
tcctttgatcgccttaattctatggaaacatcggtaacttcagaactgggatcatccata
ggggcagccattgcagcttctgtgaccgttcccccagattcagagggccaagttacattt
tcattggcatgggactgccctgaggcgaactttatgagtggaaagacatattacaggcgt
tacacaaaattctatggtactcatcagaatgcagctgcaaatattgcccgtgatgctatt
cttgagcatggtagttgggagttacagatagaagcatggcaaagacctattcttgaagac
aagaggcttcctgagtggtatcccatcactctctttaatgagctctattatctaaatgct
ggaggctcagtttggactgatggatcacctcctgtccatagtttagtaactattggccat
agaaagttttcccttgattggtcacaatcagatttgaagagaattgttgacgtaccgaat
caaaatgatactgctgtcaacattcttgagaggatgagttcaatactcgagcaaatatac
acaccagttgcactcaattctgcttttggaactaatttgcttcaagatggagaagaaaac
attggtcaattcctttatcttgaaggaattgaatatctaatgtggaacacctatgatgtt
catttctactcttcttttgcactgatcatgttatttcctaaaattcaactcagtatccaa
agagactttgcagcagctgtaatgatgcatgaccccagtaagatgaagcttctagacgac
gggcagtgggtctcaagaaaggttcttggagctgttcctcatgatattggaatttgtgac
ccatggtttgaagtaaatgcctactgcctttatgacactgccaggtggaaagacttgaat
ccgaaatttgttctacaagtgtacagggatgtcgttgccacaggagacaagaagtttgca
aaagctgtttggccctcagtttacgttgcaatggcttatatggaccaatttgatagggat
ggtgatggtatgattgagaatgatggttttcctgatcaaacatatgatacatggtcagtg
tccggtataagtgcttacagtggagggctatgggttgcagctttacaagctgcatcagct
ctggctcgtgaagtaggtgacaggggctctgaggattatttttggttcaaatttcagaaa
gcaaaagttgtatacgagaaattgtggaatggttcctacttcaattatgacaacagtggt
agcagtcaaagttcgtctattcaagctgatcaattggctggacaatggtatgcccgagca
tgtggtcttttgccgattgttgatgaagacaaagcaagaagtgcattggaaaaggtttat
aattacaatgtcttaaaggtgatgggtgggaagcggggggcagttaatgggatgctacct
gatggaagagttgacatgtcatcaatgcagtcaagagaaatatggtccggcgtcacatat
gcagttgctgcatctatgattcatgaagatttggcagacataggatttcaaactgcctgt
ggaatctatgaagctgcatggtctggaactggacttggttatgcttttcaaactccagaa
gcttggaacaccgatgaccaatacagatcactgtgctacatgaggcctttggccatatgg
gccatgcaatgggctttaacaaggccgaaacccaaaactttggaaaaatggacgaaaccc
gaagtaactgacgaatctctgcttaggtatcatgctgggttctccaaagttgcaaggctt
ctgaaactgccagaagaacaaggagccaaaagtcttttgcagtctttatttgatcacact
tgcaggagaatgtttatataa

DBGET integrated database retrieval system