KEGG   Citrus clementina (mandarin orange): CICLE_v10001624mgHelp
Entry
CICLE_v10001624mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CICLE_v10001624mg
Enzymes [BR:cic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CICLE_v10001624mg
    2.7.1.82  ethanolamine kinase
     CICLE_v10001624mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 359 aa AA seqDB search
MGAIENVMENKESRIPVEAKELLKSLASEWEDVVDRNSLQVIPVKGAMTNEVFQIKWPTK
TETFSHKVLLRVYGEGVEVFFDRNDEIRTFEFMSKHGQGPRLLGRFHNGRVEEFINARTL
SASDIRDPEISALIAAKLKEFHDLDMPGQKIVRLWDRSRNWLIATKNLSPPEEARAFRLD
AIEEEISTLEKALYRNDQHIGFCHNDLQYGNIMIDEETKSITLIDYEYASYNPVAYDIAN
HFCEMAADYHTETPHLMDYSKYPDLEERHRFLHAYLSSTGDQPSDAEVKQLLQDVEKYTL
ASHLSWGLWGIISEHVNEIDFDYIGYAKQRFDQYWLTKLELLGSSGATTNALPDGNYNI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaatagaaaatgttatggagaacaaggaaagccgtatacctgtggaagcaaag
gagcttctgaaatctttggcatctgagtgggaagatgtagttgataggaattcacttcag
gttatacctgttaagggtgcaatgaccaatgaggtcttccaaataaaatggccgacaaaa
acagaaacattctcacataaggttttacttagggtatatggtgagggagttgaggttttc
tttgacaggaatgacgagattcggacatttgagtttatgtcaaagcatgggcagggacct
cgtttgttggggcggtttcataatggccgagttgaagagttcatcaatgcacggacccta
tcagcatctgatattcgtgatccagaaatttctgctcttatagcagcaaaattgaaggag
ttccatgaccttgatatgcctggtcaaaagattgtccgcctgtgggataggtcgcgaaat
tggctcatagcaaccaagaatttgtctcccccagaagaagctagagcatttcgtttggat
gccattgaggaggaaatttctacattagaaaaggcactctatcggaatgatcagcatatt
ggtttttgccacaatgatttacaatatggtaacataatgattgacgaagagactaagtca
ataaccctaattgactatgagtatgcaagttacaatcctgtagcatatgatattgcaaat
cacttctgtgagatggctgccgactatcatacagaaacaccacatctgatggactacagt
aaatatcctgatttggaggagcgtcatcgatttctgcatgcttatctgagttccactggt
gatcaacctagtgatgcggaagtaaagcaactacttcaggatgttgagaagtatacactt
gcaagccatctgagctggggcttatggggaataatttcagaacatgtgaatgaaattgac
tttgactacattggatatgcgaagcaaagatttgaccaatactggttaacgaagcttgaa
ttgttgggatcttctggagccaccactaatgctttgcctgatggtaactataatatctag

DBGET integrated database retrieval system