KEGG   Citrus clementina (mandarin orange): CICLE_v10001757mgHelp
Entry
CICLE_v10001757mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    CICLE_v10001757mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     CICLE_v10001757mg
    1.1.1.234  flavanone 4-reductase
     CICLE_v10001757mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 338 aa AA seqDB search
MGSIAETVCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNKKKVKHLLELPKASTHLTL
WKADLAEEGNFDEAIRGCTGVFHLATPMDFESKDPENEVIRPTINGMVSIMRACKNAKTV
RRLVFTSSAGTLDVEEHRKPVYDETSWSDLDFVRSVKMTGWMYFVSKTLAEQAAWKFAEE
NNIDFISIIPSLVVGPFLTSSMPPSLITALSPITRNEAHYPIIKQGQFVHLDDLCSAHIF
LFEHPNAKGRYICSSHPATILELAKFLREKYPEFNVPTEFEDVDENMKNMLFSSKKLTDL
GFKFKYSLDDMFTGAVDTCRAKGLLPLLCENHVSEVSI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggctctatagctgagactgtgtgcgtgactggcgcttctgggtttatcggttcatgg
ctcatcatgagattgctcgagcgtggctatgctgttcgtgctactgttcgcgatcctgat
aacaaaaagaaagtgaaacatttgctggagttgccgaaggcaagcactcacctgacttta
tggaaagccgatttagccgaagagggaaactttgatgaagcgattcgaggctgcactgga
gtttttcatctggccacgcctatggactttgagtccaaggatcctgagaatgaagtgata
aggccgacaataaatgggatggtaagcatcatgagagcgtgtaaaaatgcgaagactgtg
aggaggttagtgttcacatcatcagcgggaactttggatgttgaggagcaccgaaagcca
gtttatgatgaaacctcctggagtgacttggattttgttcggtctgttaagatgactgga
tggatgtattttgtgtccaagacactggcagagcaagctgcgtggaagtttgctgaagaa
aataacattgattttatcagtataatcccaagtcttgttgttggtccattccttacgtcg
tcaatgccacccagtctcataactgcactctcgcccattacaagaaatgaagcgcattat
ccaattataaagcaaggccaatttgtgcatttggatgatctctgcagtgctcatatattt
ttgtttgagcatcctaacgcgaagggccgctacatttgctcttctcacccggcaaccatt
cttgagcttgcaaaattcctcagggaaaaataccccgaattcaatgtgcccacagagttc
gaagatgttgatgagaatatgaaaaatatgctcttctcttctaagaagctgacagatttg
ggatttaagttcaagtacagcctagatgacatgttcacaggtgctgtggatacttgcaga
gccaagggattgcttcctcttctttgtgaaaatcatgtcagcgaagtatccatataa

DBGET integrated database retrieval system