KEGG   Citrus clementina (mandarin orange): CICLE_v10008203mgHelp
Entry
CICLE_v10008203mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cic  Citrus clementina (mandarin orange)
Brite
Enzymes [BR:cic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CICLE_v10008203mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 466 aa AA seqDB search
MGQKKNPSADPVSEPKKRRRVGFSDVDEGVEANQCIKIYLVSSKEEVGVSDSFSIDPVDL
NSFFDEDGKIYGYQGLKITIWISSISFHAFADITFQSTSDRGKGITDLKSALQRIFAETL
VENKDDFLQTFSTEKDFTRSAVSSGEILQHKVSNGHVTHCNNNLKAAASDLEVVRMVVGN
MEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRF
YHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTC
VDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQ
CWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMF
KSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVSPLPV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaaaagaaaaacccttctgccgatccagtctccgagcccaagaagcgaaggcga
gtcggattctcggatgtcgatgaaggagttgaggcaaaccaatgcattaaaatttatctg
gtgtctagcaaagaggaagtaggtgtttcagacagtttctcgattgatccagttgactta
aacagcttttttgatgaagatgggaagatttacggttaccaaggtttgaagataaccata
tggattagcagtatatcgtttcatgcatttgctgatattacatttcagagcacctctgat
aggggcaaaggaattacagatctaaaatctgctcttcagaggatttttgctgagactctt
gttgagaataaagatgatttcctccaaacattttcaacagagaaagactttactagatct
gctgtatcaagtggggagatattgcaacacaaggtttccaatggacacgttactcattgt
aataataatctaaaagcagctgcttctgatttagaggttgttcgcatggtggtgggaaat
atggaagctggacacctctacagtcgtttaatacctcttgttcttcttcttgtggatgga
agcaaccctattgatgttactgatccaagatgggagttatatatcctgattcggaagaaa
atggatcagcaaggagatattcaacatagacttcttggttttacagcaatatatcgcttc
tatcattaccctgacagcacacgcatgcgactcagtcagattttgattttgcctccttac
cagcgcaagggctatggcggtttccttacagaggtgctcagcaatgttgcagtagctgaa
aatgtccacgacttcacagttgaagagccattagattccttccaacacgttcgcacttgt
gtcgacatacaacacctgcttgcttttgagccaatccagcatgcaattaactccgctgtt
tcgcatctgaagcaagggaaactatcaaaaaaaatccttgcccctcgatttgtgccacct
gccagtactgtagaggaagtcaggaaagtgttgaaaatcaacaagaaacagtttctccaa
tgttgggagattttaatatatcttcgccttgatcctgttgacaagtacatggaggattat
accacaatcatttcaaatcgtgtgagggaagatatcttaggaaaagattcaggcagtacc
gacaagcgcataatggatgtacctagctcttatgatccggagatgtcttttgtcatgttc
aagtcacagaatgttgaaactagtggtgtccaaatggatgaaaatcaaccgagtcaagaa
gagcagctgaagcagttggttgatgaaaggatcaaagagatcaagttaattgcacaaaag
gtgtctccattaccggtctga

DBGET integrated database retrieval system