KEGG   Citrus clementina (mandarin orange): CICLE_v10008206mgHelp
Entry
CICLE_v10008206mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cic  Citrus clementina (mandarin orange)
Brite
Enzymes [BR:cic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     CICLE_v10008206mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 465 aa AA seqDB search
MSLGYAEKLSYIEDVGNVGMAEFFDSPQNLQEKIEQLAKLIQKSKHLVVFTGAGISTSCG
IPDFRGPNGIWTLQREGKPLPEASLPFHRAMPGMTHMALVELEKAGILKFVISQNVDGLH
LRSGIPREKLAELHGNSFMEACPSCGSEYFRDFEVETIGLKETSRRCSDLKCGAKLRDTV
LDWEDALPPKEMNPAEKHCKIADVVLCLGTSLQITPACNLPLKCLRGGGKIVIVNLQKTP
KDKKASLVIHGFVDKVVAGVMDLLNLRIPPYIRIDLLQIIVTQSLSSDKKFVNWTLRITS
VHGQTAQLPFIKSVEVSFSDRQKYKEASLDKQPFQLKRRTVINETFDIKLKLNFSDGCGC
PCTQINIPFDFKVPPKCFELDKDDIFQRLRETAFQDLGCGQNEVIERKVLSSPKSEVTVY
AIVSNVKTFESNCLSNGDLKWLKDGVNGTETSKKRSNSRKRKSRS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaggctatgcagagaagctttcttacattgaagatgtgggcaacgttggaatg
gctgaatttttcgattcacctcaaaatttgcaagaaaaaattgaacaacttgccaaatta
atacagaagagcaagcatctagtggtgtttacaggtgcaggaatctcaacttcttgtggt
atacctgattttcgaggtccaaatggaatttggacactgcagcgtgagggaaaaccctta
cctgaagcttccctaccatttcatcgcgctatgccaggcatgactcacatggctttggtt
gaattagagaaggctggcattttaaagtttgttattagtcagaatgttgatggccttcat
cttcggtctggaattccaagggagaagcttgcagaattgcatgggaattccttcatggag
gcttgcccttcatgtggaagcgagtatttccgtgactttgaggtggaaacaattggatta
aaagagacatcacgacgttgttctgatctaaaatgtggagcaaaacttagggatacagtt
cttgactgggaggatgctctgccccccaaggagatgaatccagcagaaaagcactgtaaa
attgctgatgttgtactttgcctcggtactagtttgcagataactcctgcatgcaatttg
cctcttaaatgtctccgaggtgggggaaagattgtaattgtgaatcttcagaaaactccg
aaggacaagaaagcaagtttggtgatccatgggtttgtagataaggttgttgcaggagtg
atggacttgcttaatttgcggattcctccatatatcaggattgacctcttgcagatcatt
gtaacacaatctttgagttcagataaaaaatttgtgaactggactcttcggataacaagt
gtacatggacaaactgctcaattgccattcatcaagtctgttgaggtttccttctcagac
aggcaaaagtacaaagaagctagtttggataagcagccatttcagctgaaaaggagaact
gttattaatgaaacatttgacatcaagttgaaactcaactttagcgatggttgtggatgt
ccttgcacccaaattaatatcccttttgattttaaggttccgcccaagtgttttgaactt
gacaaggacgacatattccaaaggctaagagagacagcatttcaagatttaggctgtggc
cagaatgaagtaattgagagaaaggtcttatcatcccccaaaagtgaggtcacagtctat
gccattgtaagcaatgtcaaaacttttgaatccaattgtctgagtaacggcgatctgaaa
tggctaaaagatggtgtgaatggtactgaaacatccaagaagcggtcaaatagtcgtaag
cgtaaatcaagatcataa

DBGET integrated database retrieval system