KEGG   Citrus clementina (mandarin orange): CICLE_v10014164mgHelp
Entry
CICLE_v10014164mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00620  Pyruvate metabolism
cic00710  Carbon fixation in photosynthetic organisms
cic01100  Metabolic pathways
cic01200  Carbon metabolism
Module
cic_M00168  CAM (Crassulacean acid metabolism), dark
cic_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cic_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cic_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CICLE_v10014164mg
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CICLE_v10014164mg
Enzymes [BR:cic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CICLE_v10014164mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 18052001
NCBI-ProteinID: XP_006446789
UniProt: V4W277
Position
Unknown
AA seq 965 aa AA seqDB search
MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQTVDLVFTAHPTQSVRRS
LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRSPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTSEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNDELRARADGLHRSSKRDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERARQLLANGISDIPEDIAYTHVEQFLEPLELCYRSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESERHTDVIDAITKHLGIGSYREWSEEKR
QEWLLSELRGKRPLFGSDLPKTEEIADVLDTFHVIAELPADSFGAYIISMATAPSDVLAV
ELLQRECRVKQPLRVVPLFEKLADLEAAPASVARLFSIDWYRNRISGKQEVMIGYSDSGK
DAGRLSAAWQLYKTQEELVKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFSAATLEHGMHPPVSPKPEWRALMDEMAVIATK
EYRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVIQKDIKNLHMLQEMYNLWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEELQPFGEKLRANYAETKSLLLQVAGHRDLLEGDPYLKQRLRLRDAYITTLNVCQA
YTLKQIRDPNFHVKVRPHLSKEYMESRKPAAELVRLNPTSEYAPGLEDTVILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctgctagaaatttggagaagatggcatcaatagatgctcaattgaggctactggca
ccggctaaggtctctgaggatgacaagttggtggagtatgatgctctgttgttggatcgc
tttcttgatattcttcaggacttgcatggggaggatatcagagaaacggttcaagaatgt
tatgagctttcagctgagtatgaagggaagcgtgactctcaaaagttggaggagcttggt
aatgttttaacaagtttagatcctggggattctattgtcgttaccaaatcattttcccac
atgcttaacttggccaacctggctgaggaagttcaaattgcttatcgacgaagaatcaag
ttaaagaaaggggactttgttgatgagaattcagcaacaaccgaatcagacattgaagag
accctcaagaggctcgtcgtgcagctgaagaagtctccagaagaagtttttgatgctttg
aagaatcagactgtcgatttggtcttcactgcacatccaacccaatctgtgcgaagatct
ttgcttcaaaaacatggaaggatccgtaattgtctgactcagttgtatgctaaggacatt
actcctgatgataagcaagaacttgatgaggctttacagagagagatacaagctgctttt
cgtacagacgagatccgaaggagtcctcctaccccacaagatgagatgagagcaggaatg
agctacttccatgagacaatctggaaaggagttccgaaattcttgcgccgtgttgacact
gctttgaaaaacattggcattaatgaacgtgttccctataatgctcctctcattcagttc
tcttcatggatgggtggagatcgtgatggaaaccccagggtaacttctgaagttacaaga
gatgtttgcttactggctagaatgatggctgctaacttgtacttctcccaaatagaggac
cttatgtttgagttatcaatgtggcgttgcaatgacgaactccgtgctcgtgcagatgga
cttcataggtcctcaaagagagatgcaaaacactatatagaattctggaaacaaattcca
ccaaatgagccttatcgtgttattcttggtgatgtgagagacaagctatataatacacgg
gaacgtgctcgtcagctgttagccaatgggatttctgacattccagaggatatagcttat
actcatgtggagcagttcctggagcctctagagctctgttacagatcactctgtgcttgt
ggtgatcggccaatagccgatggaagccttcttgatttcttgcggcaagtttctactttt
ggactttcactagtaagacttgatatccgtcaagagtccgaaaggcacactgatgttatt
gatgctatcaccaagcacttgggcattggatcttatcgagaatggtctgaggagaagcgg
caggaatggcttttgtctgaacttagaggcaaacgtcctctatttggctctgatcttcct
aaaactgaagaaattgctgacgtgttggacacattccatgtcattgcagaacttcctgct
gacagctttggtgcctatataatctcaatggcgacagctccatctgacgtacttgctgtt
gagcttttacaacgtgaatgtcgtgtgaaacagcctctaagggttgttccattgtttgag
aagcttgctgaccttgaagctgctccggcttctgtggctcgtctcttctctatagactgg
tatagaaacaggatcagtgggaagcaagaggttatgatagggtattctgattcaggaaag
gatgctggccgtttgtctgcagcttggcaattatataagactcaggaagagcttgtaaag
gttgcaaagcagtatggtgttaaactcacaatgttccatggccgaggagggacagtcgga
agaggtggaggacccacccatctggctatattgtctcaaccacctgatacaattcatggt
tcacttcgtgtgacggttcaaggagaagttattgagcagtcttttggggaggagcacttg
tgcttcagaacacttcagcgtttctcagctgctacacttgagcatggaatgcatccccca
gtgtcaccaaaaccagaatggcgtgcactcatggatgagatggctgtcattgctacaaag
gaatatcgttctatagtattccaggaacctcgttttgttgaatattttcgccttgcaaca
ccagaaatggagtatggtcggatgaacattggaagtcgaccatcaaagcgaaagccaagt
ggaggtattgagtcactccgtgccatcccatggatctttgcatggactcagacgaggttc
catttacctgtgtggcttggctttggggcagcatttaaacatgtcattcagaaggacata
aagaatcttcacatgcttcaggagatgtacaatttgtggcctttctttagggtcacaatt
gacttggttgaaatggtgtttgccaagggagacccaggaattgctgctttatatgacaaa
ctccttgtgtcagaggagctgcaaccatttggagagaaacttagggctaactatgctgaa
actaaaagccttctcctacaggttgctgggcatcgggatcttcttgaaggagacccatac
ttgaagcagaggcttcgccttcgtgatgcatacatcacgacacttaatgtctgccaagcc
tacactctgaagcagatacgtgaccccaacttccatgttaaggtccgaccacacctgtcg
aaagaatacatggaatcaaggaagccagctgctgagcttgtgaggcttaaccctaccagt
gaatatgctcctggtcttgaagatactgtcattttgacaatgaagggtattgctgctggc
atgcaaaacactggttaa

DBGET integrated database retrieval system