KEGG   Citrus clementina (mandarin orange): CICLE_v10018119mgHelp
Entry
CICLE_v10018119mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CICLE_v10018119mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CICLE_v10018119mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 169 aa AA seqDB search
MLMSRGKDSEGNEVIRPYTPITLDSDIGYFELVVKMYPKGRMSHHFREMHEGEYLPVKGP
KGRLKYKVGQARAFGMIAGGTGITPMFQLTRAILENPKDKTNVHLIYANVTVGDILLKDE
LDSFATNFPNRFKVYYVLSQPTEVWNGGIGHVSKEMIQMHCPTPAPDIQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgagcagggggaaagacagtgaaggtaatgaagttattagaccatatactcca
ataactttggattctgatattggttactttgaactagttgttaagatgtatccgaaagga
agaatgtctcaccatttcagagagatgcatgaaggagaataccttccagtaaagggaccc
aaggggcgcctcaaatataaagttgggcaagctcgagcatttgggatgattgctggaggc
actggcattactccaatgtttcagctcacgcgagccattttagagaaccctaaagacaag
accaatgtgcatctcatctatgctaatgttacagttggagacattcttctgaaggacgaa
cttgatagctttgccacgaacttcccaaaccgtttcaaagtgtactacgttttgagccag
cccactgaagtgtggaatggtgggattggtcatgtgtccaaggaaatgattcagatgcat
tgtcccacaccagcccctgatattcag

DBGET integrated database retrieval system