KEGG   Citrus clementina (mandarin orange): CICLE_v10019518mgHelp
Entry
CICLE_v10019518mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cic  Citrus clementina (mandarin orange)
Brite
Enzymes [BR:cic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CICLE_v10019518mg
Transfer RNA biogenesis [BR:cic03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CICLE_v10019518mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 564 aa AA seqDB search
MATAVLPQDAKKLPRPGRGGFQAHGLTEEEARVRAIAEIVNSMVELSRKNETVDLNAIKS
AACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIA
TTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVD
KVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETR
PDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVA
HMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPE
QLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRT
REAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCP
ELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISG
VGTRHYYRKLGYELEGPYMVKYLE
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgtgctaccacaagacgccaaaaagctcccccgccccgggcggggcgga
tttcaggcccacggccttaccgaagaagaagctcgagtccgggccatcgccgaaatcgtc
aactcaatggttgaactatcacgcaaaaacgaaacggtcgacctaaacgcaataaaatcc
gccgcgtgccgcaagtacggtcttgcacgcgcccctaaattagtagagatgatcgccgcg
ctacccgagactgaccgcgaagccttgctgcccaagcttcgagccaagcccgtcagaacg
gcttccggtattgctgtcgtggccgttatgtcaaaaccacacagatgcccccatatcgcg
acgactggaaacatttgcgtgtactgtccgggtgggccagactctgattttgagtacagt
acgcagagttacactggatacgagcctactagcatgcgcgctattagagccagatacaat
ccatatgtccaggcaagaagcaggattgatcagctaaaacgtttgggtcatagcgtagac
aaggttgagttcatcttaatgggtggtaccttcatgtctctaccagcagattaccgtgat
tactttataaggaatcttcatgatgctttatctggacatacttctgccaatgttgaagag
gcagtcacttattctgagcatggtgctacaaaatgtattggcatgacaattgaaacgagg
ccagattattgccttggacctcatttgcgccaaatgctttcttatggttgtacacgattg
gagataggagttcaaagcacatatgaggatgttgctcgtgacacaaatagagggcatacg
gtagctgctgtggctgattgtttttgtctggcaaaggatgctggtttcaaggttgttgct
catatgatgcctgatcttccaaatgttggagtcgagagggacttggaaagttttcgggag
ttctttgagagcccattatttagagctgatgggcttaaaatttatcctacgcttgtgatt
cgtgggactgggctttatgagctctggaaaactggtaggtatagaaattacccacctgag
caacttgtggacatcgtcgccaggattctagccatggtacccccttggactcgagtttat
agagttcagcgtgatattcccatgcctttggttacttccggggttgagaaagggaacctt
cgggagctagctttagctcggatggatgacttgggcttgaaatgccgtgatgttcggaca
cgcgaagctggaattcaggacatccatcatcaaataaagccagaagaagtagagcttgtc
cgtcgtgattatgtggcaaatgaaggttgggaaacatttctttcgtacgaagacacacgc
caggatattcttgttggcttgttgcgcttgaggaagtgtgggcggaatgttacttgtcca
gagctcatgggcaagtgttctattgttcgtgaactccatgtgtatggaaccgctgttcct
gtgcacggtcgggaagctgacaagctgcaacaccagggttacggtacactcttaatggaa
gaggcagagcggattgcacttggagagcacagatcaagaaagatggccgttatttcaggt
gtaggaactcgacattactatagaaaattgggatacgaacttgaaggtccttacatggtg
aaatatcttgagtga

DBGET integrated database retrieval system