KEGG   Citrus clementina (mandarin orange): CICLE_v10019527mgHelp
Entry
CICLE_v10019527mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cic  Citrus clementina (mandarin orange)
Brite
Enzymes [BR:cic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CICLE_v10019527mg
Transcription machinery [BR:cic03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CICLE_v10019527mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 561 aa AA seqDB search
MDTHAHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPP
SFSADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEFENDNDSSMRTFTAARL
ENNNSVGSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTAGKEDTV
KIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNM
PKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRL
MNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMEC
KIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPG
LREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARD
VPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATR
LESHFQSKVQSGLHSSTKIQQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggatacgcacgcccactccgctcacctaaccgcaccgaaccgctcccgcagctcacag
accccgtccccgtcccactccgcctctgcatccgccacgtcatccattcacaagcgcaag
cttgcagcaacagccgcggcaggtgcgtctgaagaccacgcgccgcatgcattccctccc
tccttctccgccgacactcgtgacggcgcgttgacctcgaatgacgacctcgagagcatc
tccgcccgcggcgccgactctgacgctgacgactccgaggatgccgtcgttgacgacgat
gaggacgagttcgagaacgacaacgactcctctatgcgtactttcaccgcggctcgcctg
gagaataataattccgtcggctcggcaagaaatacgaagctaaagacggagaattcgacc
gttaaaattgagaattccgatggcgggaaggaaggggttacctccgggagtggtgtgctt
gggtccactgctctggccggtagctcggtgctgggaactgcaggtaaagaagacacggtg
aagatttttacagagaatatacaagctagtggagcttatagtgcaagagaggagctcttg
aagagagaggaggaagctggaaacctgaagttcgtatgcctttcaaatgatggtattgat
gagcatatggtttggttgataggattgaagaatatatttgcaaggcaactacctaacatg
cctaaggagtacattgtgcgtcttgtgatggatagaagccacaaatcggttatggttatc
agaggaaatgtggttgttggtggcatcacatatcgcccatatgtcagtcaaaagtttggg
gagatagctttttgtgcaatcacagctgatgaacaagtaaaaggctatggtaccagactg
atgaaccatctaaaacagcatgcccgtgatgttgatgggcttacgcattttctaacatat
gctgacaataatgctgtgggttattttattaaacagggttttaccaaagagatttacttg
gaaaaagatcgatggcaagggtatattaaagattatgatgggggaattcttatggaatgc
aaaattgatcccaagcttccatacactgatttatcgactatgattcgccgccagaggcag
gcaattgatgagaagataagggagctctccaattgtcacattgtttatcctgggattgat
tttcagaagaaagaagctggtgttcccaaaaaaatcatcaaagtcgaggacattcctggc
ttgagagaagctggatggactcctgatcaatggggccattcacggtttagaactttaact
gctgctactgacggtgcatcaaatcagaagcatttaactgcatttatgcgctcacttctg
aagtcgatgcatgaccatgttgatgcttggccgttcaaggaaccagttgatgcccgcgat
gtccccgattactacgaaatcatcaaagatcccatggatctgaggacaatgtcaaaaaga
gtggagtcagaacaatattatgtgacatttgagatgtttgttgcggatgtcaagaggatg
tttgccaatgcacgcacctataattcacccgacaccatttattataaatgtgcaaccagg
ctggaatcccactttcagagcaaagttcagtcgggactacactctagcaccaaaattcag
cagtaa

DBGET integrated database retrieval system