KEGG   Citrus clementina (mandarin orange): CICLE_v10019590mgHelp
Entry
CICLE_v10019590mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CICLE_v10019590mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CICLE_v10019590mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 545 aa AA seqDB search
MPTLTFTDISLLRPTPSLFPCPLKPTEKLRIHRLPLKLRCSIAEESKISPSKLSPNLNAA
DAATADCVIIGGGISGLCIAQALATNHSAVAPNVIVTEARDRVGGNIITVERDGYLWEEG
PNSFQPSDPMLKMVVDSGLKDDLVLGDPNAPRFVLWNGRLRPVPSSPTDLPIFDLMSIGG
KIRAGLGALGLRPPPPGHEESVEEFVRRNLGDEVFERLIEPFCSGVYAGDPSKLSMKAAF
GKVWKLEQTGGSIIGGTFKAIQEKNKAPKQPRDPRLPKPKGQTVGSFRKGLTMLPEAISK
RLGSKVKLSWKLSGVKKLDSGEYSLTYETPEGLVSLRSRSVVMTVPSYVASSLLRPLSVD
AAGALSQFYYPPVAAVSVSYPKEAIRTECLIDGELKGFGQLHPRSQGVETLGTIYSSSLF
PNRAPAGRVLLLNYIGGATNLGILSKKESELVEAVDRDLRKMLINPNAKDPLVLGVRVWQ
QAIPQFLVGHLDLLDAAKSSLRDNGYQGLFLGGNYVAGVALGRCVESAYEVASEVSNFLS
QYAYK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgttgacattcacagacatctcgcttctccggccgacaccatctctattccct
tgtcccttaaaacccaccgaaaagctccgcattcaccgactacccctcaaacttcgatgc
tcaatcgccgaagaatccaaaatttctccatctaagttgagcccaaatctcaacgctgca
gatgccgccacggcagattgtgtgattattggcggtggaatcagtggcctctgcatcgcc
caggcactcgccaccaaccacagcgctgttgctccaaatgtgattgtcaccgaggctaga
gatcgagttggtggaaacatcatcactgttgagagagatggatatctctgggaagagggg
cccaacagtttccagccctctgatcccatgctcaaaatggtggtggatagtgggttgaag
gatgatctagttttgggggacccaaatgcaccgagatttgtattatggaatgggagattg
aggccagtaccatctagtccaacagaccttcctatctttgatttgatgagcatcggaggg
aaaattagggctggccttggtgctcttggccttcgacctcctcctccaggtcacgaggaa
tcagttgaggagtttgtgcggcgtaaccttggtgatgaggtttttgagcgtctaattgag
ccattttgttcaggggtttatgcaggagatccttcaaaactaagcatgaaagcagcattt
ggaaaggtttggaaactggagcagactggtggcagtatcattggtggaacttttaaggca
atccaggaaaaaaataaagctcctaagcaacctcgagacccgcgtctaccaaagccaaag
ggccaaacagttggatcttttaggaagggacttactatgctgccagaggcaatatctaaa
aggttaggtagcaaagtcaaattatcttggaagctttcaggggtcaagaaattggatagc
ggagagtatagtttgacttatgaaacacctgaaggattggtttctctgcggagcagaagt
gttgttatgacagttccatcttatgtcgctagtagtctactacgtccactttctgtagat
gctgccggtgcactctcacaattttactacccaccagttgctgcggtgtctgtttcttat
ccaaaagaagcaattcggacagagtgcttgatagatggtgaattaaaagggtttggccaa
ttgcatccacggagccaaggggtggaaacattaggaacaatatatagctcatcacttttt
cccaaccgagcaccagctggaagggttttgctcttaaactacattggaggtgctacaaat
cttggaattttgtccaagaaggagagcgagcttgtagaagcagttgaccgcgacttaaga
aagatgcttataaatcctaatgctaaagatccacttgtattgggtgtgagagtgtggcaa
caagccattccacagttcttggttggtcatcttgatctcttagatgctgcaaaatcttct
ctgagagataatggatatcaagggctatttttagggggaaactatgtagctggtgtggct
ttgggtcgatgtgtggagagtgcttatgaggttgcatccgaggtttccaattttctatca
cagtatgcatacaaatag

DBGET integrated database retrieval system