KEGG   Citrus clementina (mandarin orange): CICLE_v10020632mgHelp
Entry
CICLE_v10020632mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CICLE_v10020632mg
Enzymes [BR:cic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CICLE_v10020632mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 377 aa AA seqDB search
MKGISLSPSNHCQLKFQNILAKQLNKPINTIPFHFTITNRQFPAHVIKCQCQRRDQNPVP
KNPINTPPPLVVVGSANFDIYVEIDRLPKVGETVAAKTSQTLAGGKGANQAACGAKLSHP
TYFVGQVGEDANGKLITDALSGCGVRLDYMNVVKDGGVPTGHAVVMLQSDGQNSIIIVGG
TNMSCWPEKFGDEDLEVVKKAGIVLLQREIPDSVNIQVAKAARSAGVPVIFDAGGMDAPI
PQELLNFIDILSPNESELGRLTGMPTDSYEQISEAVVKCHKMGVQQVLVKLGAKGSALFV
EGEKPIKQSIIPAARVIDTTGAGDTFTASFAVGFVEGKSREECLRFAAAAASLCVQVKGA
IPSMPDRKSVLNLLQYA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatatcgctttcaccatcaaaccattgtcaactcaaattccaaaacatcctc
gcaaaacaactcaacaaaccgatcaacacaatcccatttcacttcaccatcacaaatcgc
caattccccgcacatgttattaaatgccaatgtcagcgaagagaccaaaacccagtaccc
aaaaaccccattaacacgccaccaccactggtagtagttggctcagccaattttgatatc
tatgtggaaatcgacaggcttcctaaagtaggcgagacagttgcagccaagactagccag
actcttgctgggggcaagggtgccaatcaggctgcttgtggggcgaaactctcccatcca
acttactttgtgggtcaagtgggtgaagatgcaaatgggaaattgatcactgatgctttg
agtggatgtggggtgagattggattatatgaatgttgttaaagatggtggtgtccctact
ggacacgctgtggtgatgctgcagtctgatgggcagaactctattatcattgttggtggg
actaatatgagttgttggcctgagaagtttggtgatgaggatttggaggttgtgaagaag
gctgggattgttttgcttcagagggagattcctgattctgtcaacattcaagttgcaaag
gctgcaagaagtgcaggtgttccagtcatttttgatgcagggggaatggacgctccaatc
cctcaagagctgttgaattttattgatatcttgagccccaatgaatccgaacttggtcgt
ttgactggaatgccaactgacagttatgaacagattagtgaagctgtggtgaagtgtcat
aaaatgggtgttcagcaagtcctagtgaaacttggggccaagggatcggctctatttgta
gaaggggagaaaccaattaaacaatcaattataccagctgcaagagtcatagatacaact
ggagctggtgacactttcactgcctcttttgccgtgggttttgttgagggcaagtcaaga
gaggaatgtttgagatttgctgctgcagctgcttctctttgtgtccaagtgaagggagcc
attcctagcatgcctgataggaaatctgttttgaatcttcttcagtatgcttga

DBGET integrated database retrieval system