KEGG   Citrus clementina (mandarin orange): CICLE_v10020815mgHelp
Entry
CICLE_v10020815mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00941  Flavonoid biosynthesis
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Module
cic_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    CICLE_v10020815mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     CICLE_v10020815mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Motif
Other DBs
NCBI-GeneID: 18047155
NCBI-ProteinID: XP_006440487
UniProt: V4TK15
Position
Unknown
AA seq 357 aa AA seqDB search
MVTPTAPRVESLARSGIQAIPKEYVRPKEELMSIGNIFEEEEKDEGPQVPTIDIKEIDSE
DRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQA
SGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRS
LATKILSVLSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSAL
TFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGEYKSILHRGLVNKEKVR
ISWAVFCEPPRDKIILKPLPETVSEQKPAMLPPRTFQQHIEHKLFRRAQDALLSDEE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggtgactccaacagccccaagagttgagagcttggctagaagtgggattcaagcaatc
ccaaaagagtatgtacgaccaaaggaagagctaatgagcattggcaatatttttgaagaa
gaggaaaaagatgaagggcctcaagttcccacaattgatatcaaggaaattgactctgag
gacagagttgaacgcgagaaatgtcgcgaggagctcaagaaagctgccatggattggggt
gttatgcaccttgttaaccatgggatttcggatgatctcaccgaacgcgtcaagagagcc
ggtcaggcctttttcgatcagccggttgaggagaaagagaagtatgccaatgagcaggct
tcgggaaagattcagggttacggaagcaagctagctaataatgctagtggtcagcttgag
tgggaggactatttcttccaccttatttatcctgaagataaaagggatatgtccatttgg
cctaagactccaagcgactatacagaggctactagtgaatacgcaaggcaactgagaagc
ctggcgacgaaaattctgtcagtgttgtcacttggcttgggactggaagaggggaggctg
gaaaaggaagttggtggcctagaagagctccttcttcagatgaagatcaattactatccc
aaatgccctcaaccagaactggctcttggtgttgaagctcacacagatgtgagtgcactc
actttcattcttcacaacatggttccgggcctgcagctcttctacaaagacaaatgggtg
actgctaaatgtgttccgaattcgatcatcttgcacattggtgacaccattgaaattctg
agcaatggcgagtacaagagtattcttcacaggggacttgttaacaaggaaaaggttagg
atctcatgggctgttttctgtgagccaccgagggacaagattatcctcaagcctctcccg
gaaactgtctctgagcaaaagccggcaatgttacctcctcgcacctttcaacagcacatt
gagcacaagctgtttaggagggcgcaggatgctctcctctccgatgaagaataa

DBGET integrated database retrieval system