KEGG   Citrus clementina (mandarin orange): CICLE_v10025243mgHelp
Entry
CICLE_v10025243mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CICLE_v10025243mg
   00500 Starch and sucrose metabolism
    CICLE_v10025243mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CICLE_v10025243mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 580 aa AA seqDB search
MAKFSLCLLLLFTVLFGHGIVELEATHHIYSRLQTPQNETKTPWDYRFQPYRTGYHFQPP
WHWINDPNGPMIYKGIYHLFYQYNPKGAVWGNIVWAHSTSRDLINWFPHPPAIFPSQKSD
VNGCWSGSATILPGEKPVILYTGIDPDKKQVQNIAYPKDLSDPYLKEWVKSDKNPLMAPD
NVNNINASSFRDPTTAWQGPDNIWRVAIGSKINDLGFAILYKSKDFLNWVKAKRPLHAAR
HTGMWECVDFYPVAPNSHCGLDTSTLGPNVKHVLKISLDDTKHDYYTIGSYNYTTDKYTP
DKGLIDGDAGLKYDYGKFYASKTFFDSAKSRRILWGWINESQSVADDIKKGWAGVQAIPR
NIYLDGSGKQLVQWPVSELEQLRSSPPINVFDKRLEAGELHEVTGVTAAQADVEITFEIT
DISKAEEYRPRWTHAQWLCNTKNASVRGGLGPFGLRVLASSDSQEYTSVFFRVFKKADNK
PVVLMCSDQSRSSLNEDNDKTTYGAFVDVDPIKDKLSLRSLIDHSIVESFGGSGRACITA
RVYPITAIEDKARLYAFNNATEAVTISTLSAWSMKKAQIS
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccaagttttctttatgtttacttcttttatttactgttttatttggccatggaatt
gtggaacttgaagcaacacatcacatttacagcagacttcaaactcctcaaaatgaaact
aaaacgccatgggattatagatttcaaccttacagaacaggttaccattttcagcctcca
tggcattggatcaatgatcccaatggtcctatgatttacaagggaatttatcacctattc
taccaatacaatccaaaaggagcagtgtggggcaacattgtgtgggctcactcaacatca
agggatctgattaactggttcccacatccaccggccatcttcccgtcacagaaatctgat
gtcaatggctgctggtcgggttctgccacaattctccctggagaaaaacctgtcatattg
tacactggaattgaccctgataagaaacaagtgcaaaacatagcttaccccaaagattta
tcagacccttatcttaaagagtgggttaagtcagataaaaatccattgatggcaccagat
aacgtaaataacatcaacgctagctcattcagagacccaacaactgcttggcaaggtcct
gataatatttggagagtggccattggcagcaaaattaatgacttggggttcgcaattctg
tacaaaagcaaagatttcttgaactgggttaaggctaaacgccccttgcatgctgccagg
cacacaggaatgtgggagtgtgtagatttttacccggtggctcctaacagtcactgtggt
ctcgatacatcaactcttggaccaaatgtgaagcatgtgcttaagataagcttggatgac
accaagcatgattattacacaattggttcctataactatactactgataaatatacccca
gataagggattgattgatggtgatgcgggattgaagtatgactatggaaaattttacgct
tctaagactttctttgatagtgccaagagcaggaggattttgtggggttggattaatgaa
tcacaaagtgtggctgatgatatcaagaagggttgggccggagttcaggcaatccctagg
aatatttatctcgatgggtccgggaaacaactggtgcaatggccagttagtgaactcgaa
cagcttcgcagtagcccgccgataaatgtgtttgacaaacgactcgaggcaggagaactg
catgaagttaccggcgttacagctgcgcaggcagatgttgagattacttttgagataacc
gacatcagcaaagctgaagagtataggccaagatggactcatgctcagtggctttgcaac
acaaagaatgcctcagtgagaggtggtctcggtccatttgggctgagagttttggcttca
agtgactcccaagagtacacatctgttttctttagagtattcaagaaggctgacaacaaa
cctgttgtcctaatgtgcagtgaccaaagcaggtcttccttgaatgaggataatgataaa
accacttatggtgcttttgtggatgtggatcctattaaagacaaactgtctctaaggagc
ttgattgatcactccatagttgaaagctttggtgggagtggcagagcttgcatcacagcc
agagtttatccaatcacggcaattgaagataaggctcgcttgtatgccttcaacaatgca
actgaggctgtcacgatttcaactctgagtgcatggagcatgaagaaggctcaaattagt
tga

DBGET integrated database retrieval system