KEGG   Citrus clementina (mandarin orange): CICLE_v10025838mgHelp
Entry
CICLE_v10025838mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CICLE_v10025838mg
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CICLE_v10025838mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CICLE_v10025838mg
Lipid biosynthesis proteins [BR:cic01004]
 Desaturase
  First
   CICLE_v10025838mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 297 aa AA seqDB search
MAFITTSPTKPKSFTFSPLCQARKTQTDKVLAFGNSNLQHKLIKTSFVYHVYKYNKRESL
AIVNAASIESTEPKPEPEPEQIPEVETYGRILLSDVLVKRRRSLFSGRNWNSLDISTAGV
VLAMHLLALFAPFCFTWSSLRVAFGLYVVTGLLGITLSFHRNLSHRSFKLPKWLEYLFAY
CGVQSLQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDKDSVLERCGGPNN
VGDLEKQPFYRFLRSTYILHPIALGGLLYALGGFPFIVWGMVRKHFPLSCSVLIELF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggctttcatcacaacatcaccaaccaaaccaaaatctttcactttttcacctctgtgt
caagcaagaaaaactcaaaccgataaagttctggccttcggcaattctaacttacaacac
aagctaataaaaacgagctttgtgtatcatgtttataaatataacaaaagagagtcacta
gcaattgttaatgcagcatcaattgaatcgacagaaccaaagccagagccagagccagag
caaattcccgaggtggaaacttatgggagaattttgttatctgatgtgttggtgaagagg
agaagaagtttattttctgggaggaattggaactcattggatataagcacagctggtgtt
gttttggcaatgcatttgcttgctctctttgcgccattttgtttcacgtggagttctctt
agggttgcttttggactttatgttgtgactggacttctgggtatcactctttcttttcac
agaaacctttctcataggagttttaaattacccaaatggcttgagtacttgtttgcttat
tgcggagttcagtctcttcaggggaatccaattgattgggtaagcacacataggtatcat
caccagttttgtgattccgaaagggatccgcatagtcccattgaagggttttggtttagt
cacatgagttggctgtttgataaggattctgttctcgaaaggtgtggagggccaaacaat
gtgggagatttagagaagcagcctttctatagattcttaagaagcacttacattctccat
ccaattgcacttggaggcttgctatatgcactgggaggctttcctttcattgtgtgggga
atggtaaggaagcactttcctttaagctgttctgttttgattgaattgttctag

DBGET integrated database retrieval system