KEGG   Citrus clementina (mandarin orange): CICLE_v10027674mgHelp
Entry
CICLE_v10027674mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cic  Citrus clementina (mandarin orange)
Brite
Enzymes [BR:cic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CICLE_v10027674mg
Transcription factors [BR:cic03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    CICLE_v10027674mg
Mitochondrial biogenesis [BR:cic03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    CICLE_v10027674mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1766 aa AA seqDB search
MNVQAHISAGQVPNQGGLPQQNGNALQPNQMQNLVGGVSTTAAIAAGGSGGGVTPQRNMF
NADPDLLRARGFMRDRIFGMLLHRQTQTIDETQRTKFKDISKRLEEGLFKAASTKEDYMN
MDTLEARLSYLIKGRPGNNHNQRHQQLVNSSSSIGTMIPTPGMSHCGNSSLMVTSSVDSS
MIAAGGCNTIAPTTVNSGSLLSTGGIQSNSYNRSDGTLSNGYQQSPANFSVGSSGNMPSM
GVQRIASQMIPTPGFNNNSNQTNSSSNQSYMNLESNNGGGFSTVESAMVSLPQQQKQHVG
GQNSRILHNLGSHMGSGMRSGLQHKSYGFSNGALNGGLGMIGNNLLVNEPGTSEGYLTGT
QYANSPKPLQHHFDHQRPMVQGDGYGGSNADSYGTGNFYGAVTPVGSMTNTPNMNSGSLQ
SMPIAKTSATLMGNQSNFHGATQGTQVKAPSIDQSEKMNFHSSLSSRDNLLQSQQQQQFP
QQPHHVQQQQFVQHQRQQKPQSQQQHLLNNDGYGHSQMSDMICQVKREPGMEQHNEVMHS
QGPEQFQLPESQNQFQLTSAEDRSRGAQHLSVSSGQHDICSSLTQMSQPMQQMLHSHQLV
ADSHNGFNCFSIGGQSESVPQGQWHSQSQEKTHMAGNMSHEQHVQEDFRQRIAAQGEAQR
NNLSSEVSVISQSVGPRVMAEHPISRGASCRLTNGNRDRQFRNQQRWLLFLRHARRCAAP
EGKCQDVNCITVQKLWRHMDNCTSSQCPYPRCHHSKILIHHHKHCRDPSCPVCVPVKNYL
QQQKERARPKTDSCLPSSVSESCKSYDTGDASGGMISKTPAVVETSEDIQPSLKRMKIEP
SSQSLAPENKSSTVSASAIAETQVSHDVLQQDYQNVKIGMPVKSEFMEVKMEVPVSSGQG
SPHNNEMKDDVVESNNQRPDGERIVYDEPTASAKQENNKVEKESDVAKQESLTQPAENAA
ATKSGKPKIKGVSLTELFTPEQVREHICGLRQWVGQSKAKAEKNQAMEHAMSENSCQLCA
VEKLTFEPPPIYCSPCGTRIKRNAMYYTMGAGDTRHYFCIKCYNEARGDTIVVDGTTIAK
ARLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPNCYITEVERGER
KPLPQSAVLGAKDLPRTILSDHIEHRLFRRLKQERQERARIQGKSYDEVPGAEALVIRVV
SSVDKKLEVKQRFLEIFQEENYPTEFPYKSKVVLLFQKIEGVEVCLFGMYVQEFGSECQF
PNQRRVYLSYLDSVKYFRPEIKAVTGEALRTFVYHEILIGYLEYCKLRGFTSCYIWACPP
LKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKAAKENIVVDLTNLYDHFFVSTGECRAK
VTAARLPYFDGDYWPGAAEDLIYQIRQDEDGKKQNKGITKKTITKRALKASGQTDLSGNA
SKDLLLMHKLGETICPMKEDFIMVHLQHACNHCCILMVSGSRHVCNQCKNFQLCDKCFEA
EKKREDRERHPVNSREVHILEEVSNFPVTDVPADTKDKDEILESEFFDTRQAFLSLCQGN
HYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNICHLDIETGQGWRCEVCPDYDVCNAC
YQKDGGIDHPHKLTNHPSTADRDAQNKEARQLRVLQLRKMLDLLVHASQCRSPHCQYPNC
RKVKGLFRHGIQCKTRASGGCVLCKKMWYLLQLHARACKESECHVPRCRDLKEHLRRLQQ
QSDTRRRQAVMEMMRQRAAEVAGNAG
NT seq 5301 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacaggcacatatatcagcggggcaggttcctaatcaaggaggactgccccag
cagaatggaaacgcactgcaacctaatcaaatgcaaaatttagttggtggtgtttctacc
actgctgctattgctgccggtggtagtggtggtggggttactccacagcgtaatatgttc
aatgccgaccctgacctgctcagagcacgaggttttatgcgcgacagaatctttggaatg
ttattgcaccgccagacgcaaacaattgatgaaacgcagagaacaaagttcaaagatatt
tcaaaacgcttagaggagggtctttttaaagctgcttctacaaaggaggattatatgaat
atggataccttagaggctcgtttgagttatctgatcaagggcagacctgggaataatcat
aatcaaagacatcagcagcttgtaaattcttcttcttccattggtacaatgatcccaaca
cctggcatgtcacactgtgggaattcatccctaatggtcacatcgtctgtagatagttca
atgatagctgctggtggatgtaacactatagcacctacaaccgtcaactctgggagcctg
ttgtcaactggtggcatacagagtaattcctataatagatctgatggaaccctttctaat
ggatatcaacaatcacctgccaatttttccgttggttctagtggaaacatgccatcaatg
ggcgtccaaagaattgcaagtcaaatgattcctactcctggatttaacaataatagcaac
cagaccaacagcagcagtaatcagtcctacatgaatctggagtccaataatggtggtggt
ttttcaactgttgaatctgctatggtatccctaccacagcaacaaaagcagcatgttggt
ggtcaaaacagccgtatactgcacaaccttggcagccacatgggtagtggtatgaggagt
ggtttgcagcataaatcttatgggttctctaatggggctttaaatggtgggttggggatg
attgggaacaatttacttgtaaatgaacctggcacttctgagggctatttgacaggcacc
caatatgctaattctcccaagcccttacaacatcactttgatcatcagcgaccaatggtg
cagggtgatggatatggagggagcaatgctgattcttatgggacagggaacttctatggt
gctgtaacacctgttggatcaatgaccaatactccgaacatgaattcaggaagcttgcag
tctatgcccatagccaaaacaagtgctacgttgatgggtaatcagtcaaattttcatggt
gcaacacagggcacacaggttaaggctccatcaattgatcagtccgaaaagatgaatttc
cattcttccttatcttcaagagacaatcttctacagtcacaacaacagcaacaattcccc
caacagccgcatcatgttcaacaacaacaatttgttcaacatcaacgccaacagaagccg
caaagtcagcagcagcatttgttgaacaatgatggttatggtcattctcagatgtctgat
atgatctgtcaagtgaagcgtgaacctggaatggagcagcataatgaagttatgcactca
caaggtcctgaacaattccagctgcctgagtcacaaaaccaatttcagctaacttctgct
gaagaccgttcaaggggtgctcagcatctgtctgtttcatctggccagcatgatatctgc
tcatcactaacacaaatgtcccagcctatgcaacaaatgttgcattctcatcagttggtt
gcagattctcataatggttttaactgcttttctataggaggacaatcagaatcagttccg
caaggtcaatggcattctcaatcacaagagaagactcacatggcaggaaacatgtcacat
gagcagcatgtccaagaggatttccgccagaggattgctgctcaaggtgaagctcagcgt
aacaatttatcttcggaagtatctgttatcagtcaatctgttggtcctagagtcatggca
gagcacccaatttcaaggggtgctagctgcagattaaccaatggaaaccgagatagacaa
tttagaaatcaacagaggtggcttttgttcttgcgccatgctcgccgatgtgctgctcct
gaagggaaatgtcaggatgttaattgcattaccgtccaaaaattatggagacatatggac
aattgcacttcatctcaatgcccttatcctcgttgccatcattcaaaaattttgattcac
catcacaagcattgcagggacccaagttgccctgtttgtgttcctgtcaagaactatcta
cagcaacaaaaagaacgtgctcgtccaaaaactgattcttgtttgccgagttcagttagt
gagtcatgtaaatcttatgatactggagatgcttcaggtgggatgatctctaaaactcca
gcagttgtggagacttcagaagatatacaaccttctctaaaacgaatgaagatagagcca
tcttctcaatctcttgctccagagaacaaaagttctactgtatcagcttctgctattgct
gaaactcaagtatcccacgatgttctgcaacaagattaccaaaatgtcaagataggaatg
ccggtaaaatctgagtttatggaagtgaagatggaagttcctgtaagttctggacagggg
agccctcataataatgagatgaaggatgatgttgttgaaagtaacaaccaaaggccagat
ggtgagcgtattgtatatgatgagcctactgcttcagctaagcaggaaaacaataaagtt
gagaaagagagcgatgtggctaagcaagaaagtttgacacagcctgctgaaaatgctgct
gcaactaagtctggaaagccaaaaataaaaggggtatcactgactgaactattcactcct
gagcaagttagagagcatatttgtggtctcagacagtgggttggccagagtaaagcaaag
gcagaaaagaatcaagcaatggagcatgcaatgagtgagaactcttgtcagctgtgtgca
gttgagaagcttacttttgaaccaccacctatttattgctcgccatgtggtactcgtatt
aagcgaaatgcaatgtattatacaatgggtgctggtgacacacggcattatttctgtatt
aaatgctacaatgaggctcgtggtgatactattgtcgttgatgggactaccattgcaaag
gcaaggctggagaagaagaaaaatgacgaggagactgaagaatggtgggttcaatgtgac
aaatgtgaagcctggcaacatcaaatttgtgctttatttaatggtcggaggaatgatggt
ggacaagctgaatatacttgccctaattgctacataacggaggttgaaagaggagagcgt
aagcctttaccacagagtgctgtactgggggccaaagatcttccaaggacaatccttagt
gatcacatagagcatcgattatttagaagactgaagcaggagagacaagagagggcaagg
attcaaggaaaatcatatgatgaggttcctggggctgaagcacttgtaatcagagttgtt
tcatctgttgacaaaaagttggaagtgaagcagcggtttcttgaaattttccaagaagag
aattaccctacggaatttccttataaatccaaggtagttttgttgtttcagaagattgaa
ggtgtagaagtgtgcctatttggcatgtatgttcaagaatttggatctgaatgccaattt
cctaatcagcgtcgagtttatctatcatatttggattcggtgaagtattttaggcctgag
attaaagcagttactggagaggcactgcgcacatttgtttatcatgaaattttgattggt
taccttgaatattgcaagctgcgtggttttaccagctgctatatttgggcttgccctccg
ctaaagggtgaagactatattttgtattgccatccagaaattcagaaaacaccaaaatct
gataaactccgagaatggtacttggctatgttaagaaaagctgccaaggaaaacatcgta
gttgatctcactaatttatatgatcatttctttgtatccaccggtgaatgtagagctaag
gtaactgcagccaggctgccatattttgatggtgactattggcctggtgctgcagaggat
ctaatttatcagattcgtcaagatgaagacgggaaaaaacagaataaggggataaccaaa
aaaaccattacaaaaagggctctaaaagcatctggtcaaactgatctttctggtaatgcg
tcaaaggatctgctacttatgcataagcttggggagaccatttgccctatgaaggaagac
tttattatggttcatctgcagcatgcttgcaatcattgttgtattttaatggtatcgggg
agtcggcatgtgtgcaatcagtgcaaaaactttcagctttgtgataagtgttttgaagca
gaaaagaaacgtgaagatagagagagacatcccgtcaattcgagggaagtacacatcctt
gaggaagtaagtaattttccagttaccgatgtgcctgctgatacgaaagataaagatgag
attctcgaaagtgaattttttgataccagacaggcatttctgagtctttgtcaaggaaat
cattatcagtatgataccttgaggcgggctaagcattcatcaatgatggtcctttatcat
ctgcataatccaactgcacctgcatttgtgacaacatgcaatatatgccatcttgatata
gaaactggtcaaggttggcgctgtgaagtttgcccggattatgatgtatgcaatgcttgt
tatcagaaggatggcggtattgatcatccacataaattgacaaaccatccttccactgct
gatcgcgatgcacagaataaagaagccagacagctacgagtcttgcagcttagaaaaatg
cttgatcttctggttcatgcatcacaatgtcgttctccacactgccaatatcctaattgc
cgtaaggtgaaggggcttttccgacatggtatacaatgcaaaacacgtgcgtctggaggt
tgtgtcctttgtaagaaaatgtggtatctcctgcaactccatgctcgagcatgcaaagag
tctgaatgccacgtaccacgctgcagagatctcaaagaacatttgaggaggctccagcaa
cagtctgatacacggagaaggcaggctgtaatggagatgatgaggcagagagctgcagag
gttgctggcaatgctggttga

DBGET integrated database retrieval system