KEGG   Citrus clementina (mandarin orange): CICLE_v10028809mgHelp
Entry
CICLE_v10028809mg CDS       T02982                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cic  Citrus clementina (mandarin orange)
Brite
Enzymes [BR:cic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CICLE_v10028809mg
Peptidases [BR:cic01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CICLE_v10028809mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 334 aa AA seqDB search
MSWCTIESDPGVFTELIQQIQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDD
RVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGL
AINNSDAIRAAHNSFARPEPFVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGPIS
LGPCTGGQGDMDWLQMVQPVIQERIERYSKSEIRFNLMAVIKNRKEMYTAELKEFQRKRE
RILQQLASLQSERMVDKTSFEALNKSLSEVNAGIEGATEKILMEEEKFKKWRTENIRRKH
NYIPFLFNFLKILAEKKQLKPLIEKAKQKTSSSS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtgcactatcgagtctgatcctggcgtgtttactgaacttatacaacaaatt
caagtaaaaggcgttcaggttgaggagttgtattccctggaccttgattctcttaacaat
ctgaggcctgtctatgggttgattttccttttcaaatggcgtccaggggaaaaagatgac
cgtgttgtgattaaggatccaaatcctaacttgttttttgccagccaggtcattaataat
gcctgtgcaacacaagcaatcttgtctatcctcctgaattgtccagatatcgacattggc
ccggaattgtcaaagttgaaagagtttaccaagaactttccaccggaactcaaaggtttg
gctatcaacaacagtgatgcaatacgggcagcccataatagttttgctaggccggagcct
tttgttcctgaggagcagaaggctgctggcaaagatgatgatgtgtaccattttataagc
tatatacctgttgatggggtactgtatgaactcgatggacttaaggaagggcccattagc
cttggtccatgcactggcgggcaaggtgacatggattggctgcagatggtgcaaccagtg
atccaagaacgcattgaaaggtattccaaaagtgagataagattcaatctaatggcagtt
ataaagaacagaaaagaaatgtacactgctgaactcaaggagtttcaaaggaagagggaa
cgcatcctgcagcagcttgcttccttgcagtcagagagaatggtggacaaaaccagtttt
gaagcacttaataaatcactttccgaagtaaatgctggaattgaaggtgctaccgagaag
attctgatggaggaagaaaaattcaagaagtggagaaccgaaaatatcagaagaaagcac
aattatatccctttcttgtttaattttctcaagattcttgctgaaaagaagcaattgaaa
cccctaattgagaaggccaagcagaaaacaagcagctctagctga

DBGET integrated database retrieval system