KEGG   Citrus clementina (mandarin orange): CICLE_v100316312mHelp
Entry
CICLE_v100316312m CDS       T02982                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    CICLE_v100316312m
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     CICLE_v100316312m
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 347 aa AA seqDB search
MAAATESKTVHSAAVTYVSMISLLTLCPPFVILLWYTMVHADGSVIKSWDYLRQNGLQGF
IDIWPRPTAVAWKLIACFGAFEAALQLLLPGKRVEGPISPTGHRPVYKANGVAAYAVTLI
TYLSLWWFGIFNPTIVYDHLGEIYSALIFGSFIFCIFLYIKGHLAPSSTDSGSCGNIIID
FYWGMELYPRIGKNFDIKVFTNCRFGMMSWAVLAVTYCIKQYEANAKVEDSMLVNTILML
IYVTKFFLWEAGYWSTMDIAHDRAGFYICWGCLVWVPSVYTSPGMYLVNHPVHLGTQLAL
FILAAGILCIYINYDCDRQRQEFRRTNGRCLVWGKAPSKVIRLVSLK
NT seq 1043 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccacagaatcaaagactgttcattcagcagcagtcacctatgtttccatg
atttcactcctcactctctgccctccttttgtcattttgctatggtatacaatggtacat
gctgatgggtctgttatcaaatcatgggactacttgcggcaaaatgggctgcaggggttt
atagatatatggccaagacctactgctgttgcttggaaattaattgcttgtttcggagca
tttgaggctgcacttcagcttcttcttcctggcaaaagggttgagggtccgatttctcct
actgggcatcgcccagtttacaaggcaaatggtgtggccgcatatgcagttacgttaatt
acctatctaagcctttggtggtttggaatattcaaccccaccattgtttatgatcatctg
ggagaaatatattcggcacttatttttggaagcttcatcttttgtattttcttatatatt
aaaggtcacttggccccatcttccactgattctggttcatgtggaaacataataattgac
ttctactggggtatggagctgtatcctcgaattggcaagaactttgacatcaaagtattc
acaaactgcagatttgggatgatgtcttgggctgttctcgctgtcacttattgtattaag
cagtatgaagcaaatgcaaaagtcgaagattccatgcttgtaaatactatattgatgctg
atttatgttacaaaattcttcttgtgggaagctggttactggagcacaatggacattgct
catgatcgagctgggttttatatttgttggggatgcttggtatgggttccttctgtgtat
acatctcctggcatgtacctagttaaccatcctgtgcatcttggcactcagcttgcactt
tttattctagcggcaggcattctttgcatatacattaattatgattgcgacaggcaaagg
caagaatttcgtagaacaaatggcagatgcctggtttggggcaaagcaccatcaaaggtg
attcgtcttgtgtcactcaagat

DBGET integrated database retrieval system