KEGG   Citrobacter sp. FDAARGOS_156: AL515_18835Help
Entry
AL515_18835       CDS       T04313                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00071  Fatty acid degradation
cif00072  Synthesis and degradation of ketone bodies
cif00280  Valine, leucine and isoleucine degradation
cif00310  Lysine degradation
cif00362  Benzoate degradation
cif00380  Tryptophan metabolism
cif00620  Pyruvate metabolism
cif00630  Glyoxylate and dicarboxylate metabolism
cif00640  Propanoate metabolism
cif00650  Butanoate metabolism
cif00900  Terpenoid backbone biosynthesis
cif01100  Metabolic pathways
cif01110  Biosynthesis of secondary metabolites
cif01120  Microbial metabolism in diverse environments
cif01130  Biosynthesis of antibiotics
cif01200  Carbon metabolism
cif01212  Fatty acid metabolism
cif02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cif00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL515_18835
   00630 Glyoxylate and dicarboxylate metabolism
    AL515_18835
   00640 Propanoate metabolism
    AL515_18835
   00650 Butanoate metabolism
    AL515_18835
  Lipid metabolism
   00071 Fatty acid degradation
    AL515_18835
   00072 Synthesis and degradation of ketone bodies
    AL515_18835
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL515_18835
   00310 Lysine degradation
    AL515_18835
   00380 Tryptophan metabolism
    AL515_18835
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL515_18835
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL515_18835
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AL515_18835
Enzymes [BR:cif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL515_18835
Exosome [BR:cif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL515_18835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: AMH15792
Position
complement(4030630..4031808)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVIRALLERTGVDVHAVDEVILGQVLTAG
AGQNPARQSAINGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
HSQHKARMAIDAGRFKDEIVPVVTQRNGQSFVVDTDEQPRTDASAEGLARLDPTFDRLGS
VTAGNASSINDGAAAVMMMSEAKAQALNLPILARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRRAHKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtcggggcgttaaggacaccgattggctgcttccaggggacg
ctggcgcgccactctgccgttgaattaggtagcatggtgatcagggcgttactggaacgc
acgggcgtggatgttcacgccgtggatgaagtgatcctcggacaggtacttaccgcaggt
gcagggcagaatccggcgcgtcagtccgccatcaatggtgggctacccaataccgtttcc
gccatcaccattaacgatgtctgcggctcgggtctgaaagcgctgcatctggcgacccag
gctatccagtgcggcgaagccgacattgtgattgcgggcgggcaagagaatatgagccgt
gccccgcatgtccttacggatagccgcaccggcgcacagctggggaacagccaactggtc
gacagcctggtacatgacgggctgtgggatgctttcaacgactaccatatgggtgttacc
gctgaaaatctggcacgggaatatggtatcagccgcgaattacaggacgcctacgcgctt
cattcgcagcacaaagcgcggatggcaattgatgccgggcgctttaaagatgagatcgtg
ccggtagtgacccagcgtaacgggcaatcctttgtggtggataccgacgagcagccgcgc
accgatgccagcgccgaagggctggcgcgtctggatcctaccttcgacagactcggttcg
gtcacggcgggcaacgcgtcatctatcaatgatggcgctgccgcggtgatgatgatgagc
gaagccaaagcgcaggcgctgaatttacccatactggcgcgcattcgcgcctttgccagc
gtcggtgtcgatcctgctctcatggggatagctccggtatacgcgacgcgtcgctgcctt
gagcgcgtcggctggcaactggcggatgtcgatttgattgaagccaatgaagccttcgcc
gcgcaggcattatccgttgggaaaatgctggaatgggacgagcgtcgggtgaatgtgaac
ggtggggccattgcgctcggtcatccgattggcgcatctggctgccgaattctggtttcg
ctggtgcatgaaatggtgaaacgccgggcgcacaaaggactggcaacgctgtgtatcggc
ggcggtcagggggtggcgctcgctatcgaacgagattaa

DBGET integrated database retrieval system