KEGG   Citromicrobium sp. JL477: WG74_06015Help
Entry
WG74_06015        CDS       T04089                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cij  Citromicrobium sp. JL477
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cij00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WG74_06015
   00630 Glyoxylate and dicarboxylate metabolism
    WG74_06015
   00640 Propanoate metabolism
    WG74_06015
   00650 Butanoate metabolism
    WG74_06015
  Lipid metabolism
   00071 Fatty acid degradation
    WG74_06015
   00072 Synthesis and degradation of ketone bodies
    WG74_06015
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WG74_06015
   00310 Lysine degradation
    WG74_06015
   00380 Tryptophan metabolism
    WG74_06015
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WG74_06015
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WG74_06015
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WG74_06015
Enzymes [BR:cij01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WG74_06015
Exosome [BR:cij04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WG74_06015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
1239711..1241213
Genome map
AA seq 500 aa AA seqDB search
MSGQPEYHSERTPVILGVGELADRPRDLADALDPVGLMVAALRLAQDDAGDTSLLARLDR
LDIINEISWPYPDPAGELRGRLGQPDLATRYWPVGGQTPISALHEAAIDIQAGRAQIISV
CGGEAEHSVRRARREQAELPWTDKDMDFQPVRGGNFQNAAAQALGLTSPVNVYPLYENAT
RAAWRQDFDSAQSESARIWAHNSQIAAQREAAWLDGAVAPKAILSGEGGNRLIAWPYRKL
MVANPIVNQGAAFIVTSLAVARRAGVPAERLVYFHGGAAADEPRDILARSDFRRSQAMDA
VLGSVRSIADGRPATELYSCFPCVPKMARRVLDLPDDAELSVTGGLTFFGAPLNNFMGHA
VVAMVQRLRAQRGWGMLYGQGEYVTKHHAVMLGAGRPVGELPEDYRLCDLENALDSEAPR
LDQDHRGAARLETFTVIFDRSECPTHGVVIARSEADARIAARVDAEDEETIGALTGRGEQ
VGRAGSIVDSTDGFPRWRFA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccagcccgaatatcattccgaacgtacaccggtgatccttggcgtcggtgag
ttggccgataggccacgcgatcttgccgatgcactggaccccgtcgggctgatggttgcg
gcactgcggctggcgcaggacgatgcgggtgatacgagtttgcttgcccgtctggaccgg
ttggatatcataaacgaaatttcctggccctaccccgaccccgcgggggagctgcgcggc
agactgggccagcccgacttggcaacacggtactggcctgtcggagggcaaactccgatc
tccgcccttcatgaggctgcaatcgatattcaggcgggccgcgcgcagattatctcggtt
tgtggcggcgaagccgaacatagtgtgcgccgggcgcgccgcgagcaagccgaactgcct
tggacggacaaggacatggatttccagccggtgcgcggcggcaattttcagaacgctgcg
gcacaagcgctcgggctgacgagcccggtgaatgtctacccgctgtatgagaatgcgaca
cgtgcggcctggcggcaggactttgacagcgcacagagcgaaagcgcgcgaatttgggcg
cacaactcccagatcgctgcgcaacgcgaggcggcctggctcgacggtgcggtcgcgcct
aaagcaatactctctggcgagggcggcaatcgtctgatcgcatggccctatcgcaagctg
atggtggcaaatccgatcgtcaatcagggggcggccttcattgtcaccagccttgcggtg
gcacgcagggcgggtgtgcctgcggagaggctggtctattttcacggcggtgccgcagcg
gacgaaccgcgagatatcctggcgcggagcgatttccggcgctctcaagcgatggacgcg
gtgctaggcagcgtgcgtagcattgccgacgggcgccccgcgactgaactctacagctgt
tttccgtgcgtaccgaagatggcgcggcgcgttctcgacctgcctgacgatgcggaattg
agcgtgacgggcgggctcactttcttcggtgcgccgctcaacaacttcatgggacatgcg
gtggttgcgatggtgcagcggctgcgcgcgcagcgcggatggggaatgctttacgggcag
ggcgaatatgtgacgaagcatcatgcggtcatgctgggtgccggtcggccggtcggcgag
ttgccagaggattaccgcctgtgcgatctggaaaacgccctcgacagcgaagcgccgcgc
ctcgatcaggaccatcgcggcgcggcaaggctggagacctttacggtgatcttcgatcgc
agcgaatgcccgacacacggcgtggtgatcgcccggtctgaagcggacgcgcgcattgcg
gcgcgcgtcgacgccgaggatgaagagacgatcggggcccttaccggacggggcgaacag
gtcggcagggcgggaagcatcgtcgatagcaccgacggcttcccgcgctggcgatttgcc
tag

DBGET integrated database retrieval system