KEGG   Coccidioides immitis: CIMG_00103Help
Entry
CIMG_00103        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cim  Coccidioides immitis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cim01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:cim00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MKFRTLQNAYFLSHLLSPIVSFPVFPSSTSETTQLPLVIWHGLGDDFAREGLKHIAQLAE
DTHPGTYIHIIHVGDTPEADRQASFLGNVTVQLETVCKQLESDPILSTAPAVNALGFSQG
GQFLRGYVERCNSPPVRNLVTFGSQHNGIAKFQSCAATGDWVCRGAEALLRFGAWSNMVQ
SRFVPAQYFRDPEELDQYLLHSNFLADINNEREIKNEQYKRNLISLNKFAMYMFKDDNLV
VPKQSAHFAEVNSTTGYVKPLQEREIYTEDWLGLKVMDEAGSLEFLTVPGEHMQLSDRVL
KEAFEKYFGPVEVDLASHPELVLQVQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagaacgcttcaaaacgcttatttcctttcccacctcctatcacccattgtc
tctttcccggttttcccttccagtacctccgaaactacacaactgccactcgtcatctgg
catggccttggcgatgactttgcccgtgaaggcctgaaacatatcgcacaacttgccgaa
gatacacatcccggcacatatatacacattattcatgttggcgacacgcctgaagcagac
cgccaggcgtcattccttggcaatgtgaccgtccaactcgaaactgtctgcaagcagctt
gagtccgacccgattctcagcactgcgcccgctgtcaatgcactgggcttctctcagggt
ggtcagtttctgcgtggatatgtagaacgatgcaatagccctcccgtacgaaatctggtt
acgttcggaagccagcacaatggtattgcaaaattccaatcctgcgccgcaacgggtgac
tgggtgtgccgtggcgctgaggcacttttgagatttggagcgtggtcgaatatggtgcag
tctcggtttgttccggcgcagtatttccgtgatcccgaggagctcgaccagtatctcttg
catagcaatttcttggctgatatcaacaacgaacgggagatcaagaacgaacagtacaag
cgcaatctcatttcgcttaataaatttgccatgtacatgtttaaagatgacaatctggtg
gtgcccaagcagagtgcgcatttcgccgaagttaacagcacgactgggtatgttaagccc
cttcaggagcgagaaatctacactgaggattggctgggtctgaaagtcatggatgaggct
gggagtctggagtttttaacagtcccaggggagcatatgcaactgtctgaccgtgttttg
aaggaggcgtttgagaaatactttggtcccgtcgaagttgatctagcttcacaccctgaa
cttgtactgcaagttcaatga

DBGET integrated database retrieval system