KEGG   Coccidioides immitis: CIMG_00136Help
Entry
CIMG_00136        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cim  Coccidioides immitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1431 aa AA seqDB search
MVGVSAVSTMSNKMPPQRLPKSSQSRMSLSDSSTRDHNDSSSSGAELPLRTVLRKNASNA
SVARSQTYDSQAGSTAGVTGTRRRKSILERGSTFGSRDVDSARRVPSSTFGNPMRSSNTS
LDSGNPPSRTQSNAGSSTVNEENETLSENGEFLVPVNFDDFHNSITSKEPSLSHFPLPGR
GAAGYEGTVAIPKPTNRWTTGPSVQTAKEPRPAGVTRRLSNATRSGQTSAGSKPAPSSVS
STGRARRQSYVPPVPTSMVAPRRPRKSIGPGSLVSDNGESLAPPMRRPSFSRKKTMEENR
VMPNAASRNSHQETSDSAFNSAALHAVRSQKARSLQPPSHTVRDNATTSPTIGDHSRSSS
HVIRTPVKGAIVKLTTPSSSKRISIMPPHATGLGARTISPTDARRMKRMSLIPHPPPLPR
TSPTHLDLGFPRPRSSAPSPSAIPRKSVTPSSTRTTPDPHRKSYGSGISLSSSTSYNSAR
NSSGSFQARLSQNVSSSRLPTPKPRTDNNNNRNTEDDVPPVPAIPKLYESPKNEHHLSFI
SRKSSLPLEVPNFADMSKLDSDSSSSRPGDGVHVSKRTLAETPAKETKQRPPVNLSKKNL
QPLKLPPLNLLPLSVPINTKIDALREKASQDLAPQVAATPPRQINAKTPSTPMTASKASF
FNEIPPGDPGRCNTSHFALRTDFAKFRAENSSSAFDTLEFSSSRNISPYISSSLPRGGDE
PGFVRNQISDSYSKPTPSKLIGPRPQTQISSLSNTDLFAFGLTPDDAETEISFPPPSPRR
ADDRVHSKMQIISDPSMDPVKYDSMPPPKLPASATWNNLSTTRVSPTSKQAQLKSKRSTS
ISNLVNVPSPRRNQSISSEQGLAKNPSLTIDSGDTEASGNKPNSSILSPVHKLLAGSKPS
PTPKPRLQDQTGDRDDAAAEEEMRKLGSKRKDFEVAARELEDLRRRASPKERASAAQALK
VANLNIFERGEIIDFKDIYFCGTHKAKKLVGDLNASTGNFGYDDDRGDYNIVIGDHLAYR
YEIIDVLGKGSFGQVVRCVDHKTGTLVAVKIIRNKKRFHQQALVEVNILQKLKEWDPNRR
HSVVNFVQSFYFRGHLCISTELLGMNLYEFIKAHEFRGFSLKLIRRFTKQILSTLVLLHN
KRVVHCDLKPENILLVNPLQTGIRVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMSYGM
PIDMWSLGCILAELYTGYPLFPGENEQEQLACIMEVFGPPEKHLIEKSTRRKLFFDSTGK
PRDVVSSKGRRRKPSSKSLRHVLKCDDAAFLDFLARCLRWDPARRLNPHDAMNHEFITGM
KFNPRARLHLTSMGHSPAKRHTSGSTPGVRPLPEPPSKRGAARNSSNNSPVRPGVVKRQT
VQNVTSTPATKRTSNPPPAAGSALPRAAGRSASGKPDLAAAAAATSLKTRV
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcgtttctgccgtttcgaccatgtcgaacaagatgccccctcagagattgccc
aaatcatcacagtcacgcatgtccctgtcagactcgtcaactcgggatcacaatgacagc
tctagctctggagccgaactgccattacggacagtcctacgcaaaaacgcctcgaacgct
tcggttgctcgctcccagacgtacgattcacaggccgggagtacggctggtgtcaccgga
accaggaggagaaagtccattctcgagcgtggttcaacgttcggctcccgagatgtggat
tctgctcgacgggttccatcgagcacctttggtaacccaatgcggtccagcaatacctcc
ttagattccggcaatcctccgtcgcgaactcagtcaaatgcaggtagctcaacggtgaac
gaagaaaatgagacactatcggaaaatggggagttcctcgttccagttaattttgatgat
ttccacaacagcatcacgtcaaaagagcctagtttgagccattttccgttgcctggtcgt
ggtgcggctggttacgagggtacggtagccatcccaaaacctacgaatcgctggacaacg
ggtccttctgttcagactgcaaaagagccgcgaccagcaggtgtgactcggcgtcttagc
aatgctacgcgctccggtcagacttcggcgggatcaaaacctgctccgtcatctgtatcc
tcgacagggagagcaagacgccagagttacgttccccccgtaccaaccagcatggtcgct
cctcggcgacctcgaaaatcgatagggcctggaagtttggtatcagacaatggcgagagc
cttgcccctcctatgagaaggccgagcttttcgagaaagaaaacaatggaagagaatcgg
gtgatgccaaatgctgcatcccgcaactcccaccaagagacgtcggattccgccttcaat
tcagcagcgctacatgcagttcgcagccagaaggcaagatcgctgcaaccaccaagccac
accgtgcgggataatgcgacgacgagcccgactataggggaccattctcgatcttcgagc
catgtgatccgcacacctgtgaaaggtgcaatcgtcaagctgaccaccccatcttcgtct
aagaggatttcgatcatgccaccgcatgccactggattaggcgcgcgaactatcagccca
acagatgcacggcgcatgaagaggatgtcgcttattccacacccacctcccttaccccga
acctctcccacacatctcgatctcggttttccccgtccacgatcttcagctccatcccct
tcagcaatacccaggaaaagcgtgacgccgtcatccaccaggacaactccagacccgcat
cgcaaatcgtacggctctggcatatccctatcgtctagcacaagctataattctgcgcgc
aactccagcggttccttccaagcacgtctttcgcaaaacgtttcttcttctcgactccct
acacctaaacctagaacggataataataataataggaacacagaagacgacgtccctccg
gtgcccgctattcccaaactatacgagtcgcccaagaatgagcatcatctatcattcatt
tcccgaaaatctagcttaccgctagaggttccaaactttgctgatatgtcaaagttggat
tcggactccagctccagccgtcctggggatggtgtccatgtctccaagcgaacgcttgcc
gaaactcccgccaaggagacgaaacagaggccaccggtcaatctcagcaaaaagaatctc
cagccattgaagcttcctcctcttaatttactcccccttagtgttcctataaataccaaa
atcgatgcgttgcgcgaaaaggcatcccaggacttggcgcctcaggtagcggcaacgcct
ccccgtcagatcaacgcaaaaacgcccagtacaccgatgacagcatcaaaagctagcttc
tttaatgaaatccctcccggtgatccgggacgttgcaacacatcacattttgctctcaga
acggattttgcaaagtttcgagccgagaatagttccagtgccttcgatacgttggagttt
tcatcctcaaggaacatttctccttacatctcgtcttcccttcctcgaggtggtgacgaa
cctggatttgtacgcaaccaaatatcggactcatattcgaaacctacgcctagcaagctc
atcggtccgcggccacaaactcagatctcgtcgctctctaacacagatctgtttgccttt
ggtctcacgcctgatgatgctgaaacggaaataagctttccccctccctccccgcggagg
gcagatgatagagttcactccaaaatgcaaattatctccgacccttccatggatcctgtc
aaatatgatagtatgccaccgcccaaacttcccgcgtctgcgacgtggaacaacctttcc
accacgcgagtaagcccaacttcgaaacaggctcaacttaaatcgaagagaagtacatcg
atttctaatttggtaaatgtgccgtcaccacggaggaaccaaagcattagtagcgagcag
ggccttgccaagaatccaagcctgaccattgattctggtgatacggaggcatcaggtaac
aagccgaattcgtcaatcctgtcacctgtgcataagcttctggccggatcgaaaccgtcg
ccaactcccaaacctcgtcttcaagatcagaccggcgatcgagatgatgctgctgctgaa
gaagagatgcgcaaacttggtagcaagcgaaaggactttgaggttgcagcacgggagctg
gaggatctccgtcgccgagcgagcccgaaggagcgggcgtctgctgcccaagctctaaaa
gttgcgaatcttaatatttttgaaagaggagagattatcgatttcaaagacatctacttc
tgtggcactcacaaagccaaaaagcttgttggtgatctaaatgcgtcgactggcaatttc
ggctatgatgatgatcgtggtgattacaacatcgtgataggagaccacctcgcttatcga
tatgaaattatagacgtccttggaaagggaagcttcgggcaggttgttagatgtgtggac
cacaagacgggcacgcttgttgcggtgaagatcatccgaaacaaaaagagattccatcag
caggctcttgtcgaagttaatattttacagaagctgaaagaatgggacccaaaccgtcgc
catagcgtcgtaaactttgtccaaagcttttacttccgtggccatctttgcatatctacc
gagctgctgggaatgaatttatatgaattcatcaaggcacacgagttccgtggcttctcg
ctgaaattgattcgacggttcacaaagcagatcttgagtacacttgtccttcttcacaac
aagagggttgtccattgtgatttgaagccggagaatattctgctggttaaccctctccaa
accggaatcagggtcatcgacttcggctcgagttgttttgagaacgaaaaagtgtacact
tacatccagagccgcttctatcgctccccagaagtgattttaggcatgtcctacggcatg
cccattgacatgtggagtcttggttgtatcttggctgaactatacacgggctatcctctc
ttccccggagaaaacgagcaagagcagctggcatgtattatggaagtctttggccctcca
gagaagcatctcatcgaaaaaagcactcgacgaaaactcttctttgactctaccggcaaa
ccccgcgatgtcgtttcatccaaaggccgtcggagaaagccaagttccaagagtctccgc
catgtgctaaaatgcgacgatgccgcgttcctcgatttcctagcacgatgtctccgatgg
gacccagcgcgtcgcctcaatccacacgatgcgatgaaccacgagtttattactggcatg
aagttcaatccccgtgcaaggttgcacttaacgtccatgggtcattctcccgcaaaaaga
catacatcgggttcaacgccaggcgtacgccctcttccggaaccaccgtcgaagcgagga
gcggcaaggaattcttccaataattctcccgttagacccggcgttgtaaaacgtcagacg
gtacaaaacgtcacctccacgccggcgacaaaacggacttccaaccctcctcccgcggcc
ggttctgccctcccgagagctgcaggcagaagtgcgagtgggaagccagatctggctgca
gctgcggctgcaactagtttgaagactagagtttag

DBGET integrated database retrieval system