KEGG   Coccidioides immitis: CIMG_00220Help
Entry
CIMG_00220        CDS       T01114                                 

Definition
NADPH--cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CIMG_00220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
MAQVDSLDLVVLTVLLVGSVAYFTKGTYWGVPKAAAAASYGSANGMPKEGKTRNIIEKMD
ETGKNCVVFFGSQTGTAEDYASRLAKEGAQRFGLKTMVADLEDYDFENLDQFPEDKVAFF
VLATYGEGEPTDNAVDFYQFMTGEDVSFEGGASAEEKPLSSLRYVTFGLGNNTYEHYNAM
VRQVDAALTKLGAKRIGTAGEGDDGSGTMEEDYLAWKEPMWKALSEEMGLEEREAVYEPT
FCITEEPTMSPTSENVYVGEPNQNHLEGNLGGSHNAHNPFIAPITESRELFTVKDRNCLH
LDIGIQGSTLNYQTGDHLAVWPTNAGKEVDRFLQVFGLEDKRHTVVKIKPIDVTAKVPFP
TPTTYDAAVRYYMEICGPVSRQFIATLAQFAPDEDTKSKMKRLGEDKDHFHSQISTQFYN
IAQALQSITSKPFTSVPFSLLIEGISKLQPRYYSISSSSMVQKDRISITTVVESIRVPGA
GHVMKGVTTNYLLALKQKQHGDTNPDPHGLTYEITGPRNKYDGIHVPVHVRHSNFKLPSD
PSKPIIMVGPGTGVAPFRGFIQERVAQAERGDKVGPTVLFFGCRNRDEDFLYKDEWEAVS
EKLGDNFKLFTAFSRESEKKVYVQHRLRENAVLVNELLKNKATFYVCGDAANMAREVNTI
LGQIISEQRGLPLEKGEEFVKNMRNMGMYQEDVWS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggttgactcccttgatctcgtcgtcctgacagtgctccttgtgggcagcgtt
gcgtatttcacaaaggggacgtactggggcgtcccgaaggcagctgccgcagccagctat
ggctctgccaacgggatgcccaaagaaggcaagacgagaaacattatcgagaagatggat
gaaaccgggaaaaattgcgttgtattctttggatctcagacgggaacggcggaagattat
gcgtcaaggctcgcaaaggaaggagcccaacggtttggcttgaagacgatggtcgctgat
ctggaagactacgacttcgagaacctggatcagttccccgaggataaggttgctttcttc
gtcctggccacttatggtgagggcgagcccacggacaacgcggtggatttctaccagttc
atgacgggagaagacgtttctttcgaaggcggagcctccgcagaagagaagccattgtca
tcattgagatatgtcacattcggtctgggaaacaacacctatgagcactacaacgccatg
gtccgccaggttgacgctgcactgaccaaactcggcgctaagagaatcggtactgcaggt
gaaggcgatgatggctccggcactatggaagaggattatctcgcctggaaggaacccatg
tggaaagcgttatccgaagagatgggcttggaggagcgtgaagccgtttacgagcccaca
ttctgcatcacggaggagccaaccatgtcaccaacgtccgaaaatgtttacgtcggcgag
ccgaatcagaaccatcttgaaggaaacctgggcggctcccacaatgcgcacaatcctttc
attgccccaattacggagtctcgcgaattgtttaccgtcaaggaccgtaactgcttgcat
ctggacattgggatccagggaagtacgctcaattatcaaactggcgaccatcttgccgtc
tggcccacaaatgctggcaaggaggtcgatcgtttcctgcaggtttttggattggaagat
aagcgccatactgttgtcaagattaaacccatcgatgtgacggctaaggtccctttccct
acgcctaccacctacgacgccgccgttagatactacatggagatttgcggacctgtttcc
cgacagtttattgcaactctggcccagttcgccccggatgaggacaccaagtcgaagatg
aagcgcctcggtgaagataaagaccatttccacagccaaatttccacccagttctacaac
attgcacaggccctccagagcatcacctcgaagcccttcacgtccgttcctttctcgctc
ctaattgaaggtatctccaagcttcagccacgctactactcgatctcctcgtcatcgatg
gtccaaaaagataggatcagcattacgactgttgttgagtccatccgcgtgccgggtgcc
ggtcatgtcatgaaaggtgtcaccacaaattacctccttgccttgaaacaaaagcaacac
ggcgacaccaacccggatccgcacggtttgacctatgagattaccggccctcgaaacaaa
tatgacggcattcacgttccggtccacgttcgtcactcgaatttcaagctgccttccgat
ccgtccaagccgatcatcatggttggccctggaactggtgtcgccccgttccgcggattc
atccaggaacgagttgcgcaggccgaacgaggcgacaaagtgggcccaaccgttcttttc
tttggctgcagaaaccgcgacgaagatttcctgtacaaagatgagtgggaggccgtatcc
gaaaagctcggcgacaactttaagctgttcactgccttctctcgagagagcgagaagaaa
gtttacgtgcaacaccggctccgagaaaacgccgtgttagtgaacgaacttctcaagaac
aaagcgactttctacgtttgcggagatgccgccaacatggctcgtgaagtgaacaccatc
ctcggacagatcatctctgaacaacggggtcttccattggagaagggagaggagttcgtc
aagaacatgcgcaacatgggaatgtatcaagaggatgtgtggtcatga

DBGET integrated database retrieval system