KEGG   Coccidioides immitis: CIMG_00224Help
Entry
CIMG_00224        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
cim  Coccidioides immitis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CIMG_00224
   03420 Nucleotide excision repair
    CIMG_00224
   03430 Mismatch repair
    CIMG_00224
   03440 Homologous recombination
    CIMG_00224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 296 aa AA seqDB search
MEYGYGDQFPSGSYGQGGGGGGGGGEGGFMSEVGASQSGKTYNKSSLRPVTIKQLNDATQ
AYSDADFKIDDTEVAQVSFVGQIRNISQLSTFMTYKLDDGTGEIEVKKWLDNEERHEGDA
MDTSDPTTGRTGKKELVVNGYAKVWGKLGSFSNNRRSVTAHVIRTLTNMDEYHCHFLEAT
AIHLYFKHGPPPSKDAADASKAQTSGSGGAMRSDNSMAAGERTLPPMSPMARKLFNTLNN
TPQSREGLHLQHLASLMQAPVDNVEKAARELNDLSLIYPTVDDYTWTIMDFKVDMQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggagtacggatacggcgaccagttcccctctggctcatatggccaaggtggtggtggt
ggtggtggtggtggtgaaggaggatttatgagtgaggtgggagctagtcaaagcggaaag
acatacaacaagagttcgcttcgaccggtcacgatcaagcaactaaatgatgcgacgcaa
gcctattcggacgcagattttaaaatcgacgatactgaagtcgcccaggtctcatttgta
ggccagatccgcaacatatcccagttatcaacattcatgacatacaaactggacgacgga
acgggggaaatcgaagtgaaaaaatggctggacaacgaagagcgacacgagggtgatgct
atggacacaagcgaccctacaacaggccgtacggggaaaaaggaactcgtggtgaatggg
tacgcaaaagtatggggaaaactgggctcgttcagcaacaatcgtcgttcagttactgca
catgtaattcggacgctgacgaatatggatgaataccactgccacttccttgaagctaca
gcgatacatctctactttaaacatggcccgccaccaagtaaagacgcagccgacgcttca
aaggcccagacctctggctccggaggggcgatgcgctcagataacagtatggccgcgggc
gagaggactcttccgccaatgtctcccatggctaggaaattgttcaacaccttgaataac
actccacagagcagagaggggctgcatctacagcacctggcgtctctcatgcaggcaccg
gtcgataatgtggaaaaggctgcgcgggagctgaacgacttgagtttgatctatccgact
gtggatgattatacttggaccataatggattttaaggtcgatatgcagtaa

DBGET integrated database retrieval system