KEGG   Coccidioides immitis: CIMG_00224Help
Entry
CIMG_00224        CDS       T01114                                 

Definition
(RefSeq) replication factor A2
  KO
K10739  
replication factor A2
Organism
cim  Coccidioides immitis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CIMG_00224
   03420 Nucleotide excision repair
    CIMG_00224
   03430 Mismatch repair
    CIMG_00224
   03440 Homologous recombination
    CIMG_00224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 296 aa AA seqDB search
MEYGYGDQFPSGSYGQGGGGGGGGGEGGFMSEVGASQSGKTYNKSSLRPVTIKQLNDATQ
AYSDADFKIDDTEVAQVSFVGQIRNISQLSTFMTYKLDDGTGEIEVKKWLDNEERHEGDA
MDTSDPTTGRTGKKELVVNGYAKVWGKLGSFSNNRRSVTAHVIRTLTNMDEYHCHFLEAT
AIHLYFKHGPPPSKDAADASKAQTSGSGGAMRSDNSMAAGERTLPPMSPMARKLFNTLNN
TPQSREGLHLQHLASLMQAPVDNVEKAARELNDLSLIYPTVDDYTWTIMDFKVDMQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggagtacggatacggcgaccagttcccctctggctcatatggccaaggtggtggtggt
ggtggtggtggtggtgaaggaggatttatgagtgaggtgggagctagtcaaagcggaaag
acatacaacaagagttcgcttcgaccggtcacgatcaagcaactaaatgatgcgacgcaa
gcctattcggacgcagattttaaaatcgacgatactgaagtcgcccaggtctcatttgta
ggccagatccgcaacatatcccagttatcaacattcatgacatacaaactggacgacgga
acgggggaaatcgaagtgaaaaaatggctggacaacgaagagcgacacgagggtgatgct
atggacacaagcgaccctacaacaggccgtacggggaaaaaggaactcgtggtgaatggg
tacgcaaaagtatggggaaaactgggctcgttcagcaacaatcgtcgttcagttactgca
catgtaattcggacgctgacgaatatggatgaataccactgccacttccttgaagctaca
gcgatacatctctactttaaacatggcccgccaccaagtaaagacgcagccgacgcttca
aaggcccagacctctggctccggaggggcgatgcgctcagataacagtatggccgcgggc
gagaggactcttccgccaatgtctcccatggctaggaaattgttcaacaccttgaataac
actccacagagcagagaggggctgcatctacagcacctggcgtctctcatgcaggcaccg
gtcgataatgtggaaaaggctgcgcgggagctgaacgacttgagtttgatctatccgact
gtggatgattatacttggaccataatggattttaaggtcgatatgcagtaa

DBGET integrated database retrieval system