KEGG   Coccidioides immitis: CIMG_00305Help
Entry
CIMG_00305        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K13728  
mitotic spindle assembly checkpoint protein MAD2B
Organism
cim  Coccidioides immitis
Module
DNA polymerase zeta  complex
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MMAHRAAHPAAATDTPSPATDATHFPTTAAPAANPGSGPPAKPLLPPSSPTTTENRVPDT
YARLASSFSSFLAVSMHQILFLRSVYPPATFLPVRQYNHPVKQSRHPGVCSWINDACSFV
EAALIKSSISAASFVIVSERTNRPLERYTFDFSQIPQVSSTDIHTPFASAVAAKTGNIEK
FEILQQSANAAQSIPKSVPSTATVDTEAQFRGVLARLASACARLTPLPQHEEYRPALFVI
LRPNAEPPAGITAEEQWWIPTEPNGLSTVPTESVNGDFPERKSFGNSNSKGLNENNKRPC
PISPKTPSNGTPNNCKRSRAPQTVPVRRVDAGEMQLEVWAEEAYGKFEILDRLNTG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgcacagagctgcccacccggctgctgcgactgataccccgtcgccagccact
gacgcaactcatttcccaacaactgcggctcctgcagccaaccctggttctggccctccc
gcaaaacctcttctcccgccaagcagtccgaccaccactgagaaccgtgttcccgatacc
tatgctcggctcgcgtcctcgttttcttcttttctcgccgtgagcatgcaccaaatcctg
tttcttcgctctgtctatccgccagccacttttcttcccgtccgtcaatataaccacccc
gtcaaacagtcgcgccaccctggcgtctgttcttggatcaacgacgcgtgttcattcgtc
gaagccgcactgataaaatcttcaatctcggctgcatcattcgtcatagtctccgaaagg
acaaaccggccattggaacggtatactttcgacttttcccagataccgcaggtgtcgtcg
acagacatccatacgccatttgcgagcgctgtcgctgctaaaactggcaatatcgagaaa
tttgagatcctccaacaatccgcaaatgctgcccagtctattcccaagtctgtcccatca
acggccaccgttgacacggaggctcaatttcgaggtgtcctcgcacgattggcgtcggcg
tgtgcaaggctgactccacttccgcagcatgaagaatatcgccccgcgcttttcgtcata
ttacgccccaatgcagaaccccctgctggtataacagcggaggaacagtggtggattcca
actgaacccaacggcctttctaccgtgcccactgaatcggtgaatggggacttcccagaa
cgaaaatcttttggaaatagcaattctaagggcctaaacgaaaacaacaagaggccctgc
cccattagcccaaagacccccagtaatggcactcccaacaattgcaaacgctcaagagcg
ccgcaaaccgtccctgttcgcagggttgatgctggagagatgcagctggaggtgtgggcg
gaagaagcgtatgggaaattcgagattctggaccgccttaataccggataa

DBGET integrated database retrieval system