KEGG   Coccidioides immitis: CIMG_00305Help
Entry
CIMG_00305        CDS       T01114                                 

Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2B
  KO
K13728  
mitotic spindle assembly checkpoint protein MAD2B
Organism
cim  Coccidioides immitis
Module
DNA polymerase zeta  complex
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MMAHRAAHPAAATDTPSPATDATHFPTTAAPAANPGSGPPAKPLLPPSSPTTTENRVPDT
YARLASSFSSFLAVSMHQILFLRSVYPPATFLPVRQYNHPVKQSRHPGVCSWINDACSFV
EAALIKSSISAASFVIVSERTNRPLERYTFDFSQIPQVSSTDIHTPFASAVAAKTGNIEK
FEILQQSANAAQSIPKSVPSTATVDTEAQFRGVLARLASACARLTPLPQHEEYRPALFVI
LRPNAEPPAGITAEEQWWIPTEPNGLSTVPTESVNGDFPERKSFGNSNSKGLNENNKRPC
PISPKTPSNGTPNNCKRSRAPQTVPVRRVDAGEMQLEVWAEEAYGKFEILDRLNTG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgcacagagctgcccacccggctgctgcgactgataccccgtcgccagccact
gacgcaactcatttcccaacaactgcggctcctgcagccaaccctggttctggccctccc
gcaaaacctcttctcccgccaagcagtccgaccaccactgagaaccgtgttcccgatacc
tatgctcggctcgcgtcctcgttttcttcttttctcgccgtgagcatgcaccaaatcctg
tttcttcgctctgtctatccgccagccacttttcttcccgtccgtcaatataaccacccc
gtcaaacagtcgcgccaccctggcgtctgttcttggatcaacgacgcgtgttcattcgtc
gaagccgcactgataaaatcttcaatctcggctgcatcattcgtcatagtctccgaaagg
acaaaccggccattggaacggtatactttcgacttttcccagataccgcaggtgtcgtcg
acagacatccatacgccatttgcgagcgctgtcgctgctaaaactggcaatatcgagaaa
tttgagatcctccaacaatccgcaaatgctgcccagtctattcccaagtctgtcccatca
acggccaccgttgacacggaggctcaatttcgaggtgtcctcgcacgattggcgtcggcg
tgtgcaaggctgactccacttccgcagcatgaagaatatcgccccgcgcttttcgtcata
ttacgccccaatgcagaaccccctgctggtataacagcggaggaacagtggtggattcca
actgaacccaacggcctttctaccgtgcccactgaatcggtgaatggggacttcccagaa
cgaaaatcttttggaaatagcaattctaagggcctaaacgaaaacaacaagaggccctgc
cccattagcccaaagacccccagtaatggcactcccaacaattgcaaacgctcaagagcg
ccgcaaaccgtccctgttcgcagggttgatgctggagagatgcagctggaggtgtgggcg
gaagaagcgtatgggaaattcgagattctggaccgccttaataccggataa

DBGET integrated database retrieval system