KEGG   Coccidioides immitis: CIMG_00541Help
Entry
CIMG_00541        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cim  Coccidioides immitis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cim04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 524 aa AA seqDB search
MADAFKARTLKRKNVKGLALNAAASKLGSKPSDGDAQIPGAIGNTDSNRTDTLEIGLEFQ
LDLRSEDLMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRH
CDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVY
LYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEA
YSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKS
DAFPAILDEFVAKCLLKKPGERPTPRELFDHDAFIQAAKRTPVNLREWAISMMDRHNRKS
YLAPPAPRAINRDGSRDSISESRSQQQPDPHSHPTPTSGEIPLNYSHEPYIQRDEQTPRA
SNPSPTLGLEHLNINNHSQPQVNGQAGWPRRSPYTPGHHSNTNSPQAFTSPRAAPSPRHP
SPRNPPQSAGLPLRTGPPSNGQMPPPPPASSGLGSWSRSQGNRA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgccttcaaagcccgaacgctaaaacggaagaatgttaaaggtctcgcactt
aatgccgcagcatcgaaactgggatcaaaaccgtccgatggggacgcacaaatccccgga
gcgattgggaatactgacagcaaccgcacggacacccttgagatcggattggagtttcaa
ctggatctgcggagtgaagacctaatggtcctgaaggagcttggggctggcaatggagga
acagttagcaaagtgatgcatgcctccacaaaagtaatcatggctagaaaaatcatccgg
gttgatgctaaagagaaggtcagaaagcaaatattgagggagctgcaagtcggccgtcac
tgtgactctccttatatcgttacgttctatggtgcgttcacaaacgaggctcgggatatt
gtgctgtgtatggagtacatggatggtggttctctcgatcgcatttcgaaagattttgga
cctgttcgggttgatgttctaggaaagatcgcggagtcaatcttcgccggccttgtctat
ctatacgaagcacaccgtatcatgcatagagacattaagccatctaatgttctcgttaat
tctagaggacatattaaactctgcgactttggcgttgcaacggaaactgtcaactctgtg
gcggacacattcgttggcacttcgacctacatggcccctgagcggattcagggggaggcc
tactccgtgcgatccgacgtatggagcgccggactaacgattatggaactagcagttggt
cgtttcccatttgactcgtcagatacagctgctggagacagggctagtgctggcccgatg
ggcattctggacttgttacaacagatagtccatgagcccgccccaaagcttccaaaaagc
gatgccttccccgcgattctagacgaatttgttgctaaatgtttgcttaagaaaccagga
gaacggccaactccacgtgaactttttgaccacgatgctttcatccaagctgccaagaga
actccagttaacctccgagaatgggccattagcatgatggacaggcacaatagaaagtcc
tacctggcgccaccagcccctcgagcgatcaaccgggacgggtcaagagactccatatct
gagtcgagatctcaacagcagccggatcctcattcccacccaactcctacctctggggaa
attcccttgaattactcgcatgaaccatatattcaacgcgacgaacaaacacctcgcgca
agcaacccctctccaactctcggcctcgagcacctcaatatcaacaaccatagccaaccc
caagtaaatggccaggctgggtggcctagaagatctccatatacgcctggtcatcattcc
aataccaattcacctcaggcgttcacgtcgccacgggctgctccgtcacctcgtcaccca
tcgcctagaaatcccccacagtccgccggcctgccactacggactggccctccatccaat
gggcaaatgcctcctcctccaccagcctctagtgggctaggttcgtggtcacggagtcag
ggtaatcgggcttga

DBGET integrated database retrieval system