KEGG   Coccidioides immitis: CIMG_00589Help
Entry
CIMG_00589        CDS       T01114                                 

Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CIMG_00589
Transcription machinery [BR:cim03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CIMG_00589
Chromosome [BR:cim03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CIMG_00589
   HAT complexes
    PCAF complex
     CIMG_00589
    STAGA complex
     CIMG_00589
    TFTC complex
     CIMG_00589
    SAGA complex
     CIMG_00589
    SLIK complex
     CIMG_00589
    ADA-HAT complex
     CIMG_00589
    HAT-A2 complex
     CIMG_00589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 406 aa AA seqDB search
MAPITADRSKRKATDEPSTPDSKQKVKKARTESPGSEIKDDSASKPTLKIVPFAEKPAVL
EERRGDIEFRVVNNDGSRESFIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSMAIVKH
PLEVVGGITYRPFKGRRFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSEVMHFLTYA
DNYAIGYFKKQGFTKEISLDKSIWMGYIKDYEGGTIMQCTMIPKIRYLESGRMLLKQKEA
VHAKIRAFSKSHIIHAPPKEWRNGVCEIDPLSIPAIKESGWSPDMDELARQPRHGPNYNQ
LLHLLNDMQNHSAAWPFAQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDLYPAPQDFIKD
AMLIFDNCRRYNNENTPYAKSANKLEKFMWQQIKNIPEWSHLAEGH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgattacggctgaccgtagcaagcgcaaggcgaccgacgagccgagcacgcca
gattcgaagcaaaaggtcaaaaaggcccggactgagtccccaggctctgagattaaggat
gactccgccagcaagcccacgctcaagatcgtcccattcgccgagaagccggcagtgctg
gaagaacgacgcggtgatatagagttccgcgtggttaacaacgacgggtccagagagagc
ttcatcatcctcacaggtctcaagtgtatattccagaagcagttgccgaagatgccgaaa
gactatattgcgcgactggtatacgataggacccatttatccatggctattgttaaacac
ccattggaggtagttggagggattacatatcggcccttcaaagggcgaaggtttgcagag
attgtgttttgcgccatatcttccgaccaacaagtcaaaggttatggtgctcacttaatg
tctcacctgaaggactacgtgaaagctacttctgaggtgatgcatttcctaacatacgcc
gataattatgccatcggatacttcaagaagcaaggtttcacaaaagagatcagcttggac
aagtcaatttggatgggttatatcaaggattacgaaggcggcaccatcatgcagtgcacc
atgatcccaaaaatccggtatctcgaatctggtcgcatgcttttaaagcaaaaggaggct
gttcacgccaaaatccgggcctttagcaagtcccatattatccacgctccacccaaggag
tggagaaacggggtctgcgagattgaccctctcagcattcctgccataaaagagtctgga
tggtctcctgatatggatgagctggcccgccagccacgacatggccctaattacaatcaa
cttttacatctactcaacgatatgcagaatcacagcgcagcttggcccttcgcacagccg
gtgaatcgggacgaagtccccgactactatgaagtgatcaaggagccgatggatctgtca
accatggaagagaaacatgaaaaggatctgtaccctgctccacaagatttcattaaggac
gctatgttgattttcgataactgccggcgttataataacgagaatacaccttatgccaag
agcgcgaacaaactggaaaaatttatgtggcagcagataaaaaatatcccagagtggtcg
catctggccgagggtcattga

DBGET integrated database retrieval system