KEGG   Coccidioides immitis: CIMG_00589Help
Entry
CIMG_00589        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CIMG_00589
Transcription machinery [BR:cim03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CIMG_00589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 436 aa AA seqDB search
MAPITADRSKRKATDEPSTPDSKQKVKKARTESPGSEIKVGIVIVLKVDDSASKPTLKIV
PFAEKVRGAGTYRVYVEILLMEPPVQPAVLEERRGDIEFRVVNNDGSRESFIILTGLKCI
FQKQLPKMPKDYIARLVYDRTHLSMAIVKHPLEVVGGITYRPFKGRRFAEIVFCAISSDQ
QVKGYGAHLMSHLKDYVKATSEVMHFLTYADNYAIGYFKKQGFTKEISLDKSIWMGYIKD
YEGGTIMQCTMIPKIRYLESGRMLLKQKEAVHAKIRAFSKSHIIHAPPKEWRNGVCEIDP
LSIPAIKESGWSPDMDELARQPRHGPNYNQLLHLLNDMQNHSAAWPFAQPVNRDEVPDYY
EVIKEPMDLSTMEEKHEKDLYPAPQDFIKDAMLIFDNCRRYNNENTPYAKSANKLEKFMW
QQIKNIPEWSHLAEGH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgattacggctgaccgtagcaagcgcaaggcgaccgacgagccgagcacgcca
gattcgaagcaaaaggtcaaaaaggcccggactgagtccccaggctctgagattaaggtt
ggaattgtgatagttctcaaagttgatgactccgccagcaagcccacgctcaagatcgtc
ccattcgccgagaaggtaaggggagcgggaacataccgcgtttatgttgaaatattgctg
atggaacctccggtgcagccggcagtgctggaagaacgacgcggtgatatagagttccgc
gtggttaacaacgacgggtccagagagagcttcatcatcctcacaggtctcaagtgtata
ttccagaagcagttgccgaagatgccgaaagactatattgcgcgactggtatacgatagg
acccatttatccatggctattgttaaacacccattggaggtagttggagggattacatat
cggcccttcaaagggcgaaggtttgcagagattgtgttttgcgccatatcttccgaccaa
caagtcaaaggttatggtgctcacttaatgtctcacctgaaggactacgtgaaagctact
tctgaggtgatgcatttcctaacatacgccgataattatgccatcggatacttcaagaag
caaggtttcacaaaagagatcagcttggacaagtcaatttggatgggttatatcaaggat
tacgaaggcggcaccatcatgcagtgcaccatgatcccaaaaatccggtatctcgaatct
ggtcgcatgcttttaaagcaaaaggaggctgttcacgccaaaatccgggcctttagcaag
tcccatattatccacgctccacccaaggagtggagaaacggggtctgcgagattgaccct
ctcagcattcctgccataaaagagtctggatggtctcctgatatggatgagctggcccgc
cagccacgacatggccctaattacaatcaacttttacatctactcaacgatatgcagaat
cacagcgcagcttggcccttcgcacagccggtgaatcgggacgaagtccccgactactat
gaagtgatcaaggagccgatggatctgtcaaccatggaagagaaacatgaaaaggatctg
taccctgctccacaagatttcattaaggacgctatgttgattttcgataactgccggcgt
tataataacgagaatacaccttatgccaagagcgcgaacaaactggaaaaatttatgtgg
cagcagataaaaaatatcccagagtggtcgcatctggccgagggtcattga

DBGET integrated database retrieval system