KEGG   Coccidioides immitis: CIMG_00787Help
Entry
CIMG_00787        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cim  Coccidioides immitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cim00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 410 aa AA seqDB search
MMRFSYWQGLLLGLLICWKPVAGHQDHQHGEQAPINEKDLLKKWGQEWAFSGISTFAHLK
HVKCLLEPDELYDIAIIGAPFDTAVTYRPGARFGPRAIRAASSRQVPGLAYNTRAGINPY
LSWARILDCGDIPVVPFDNAIAESQMYEAFLELGSRPTPKNGKPKLITLGGDHSIALPAL
RALYKIYNKPITVVHFDAHLDTWNTLRYSEVWTSEQSRFTHGSFFYTASLEGLISNTSSV
HAGLRTRLTGTDDGDYTNQGPEQGFMRIHADDIDDIGVKGVIDAIISRVGLLPDEPVYLS
LDIDVLDPSIAPGTGTPEPGGWTTRELIRILRGIEKLNLVGADIVEVSPTYDGHGEGTAL
AAAQMVYELLASMVKLELKEEAEVQTTVRDKEQHFMFPQQQSDEGLEIIA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttttcatactggcagggactcctcctggggctattaatctgttggaagccc
gtcgctggccatcaggaccaccagcatggcgagcaggcgccaattaatgaaaaggacctg
ctcaagaaatgggggcaggaatgggcgttctcgggcatttccacctttgcgcacctcaaa
catgttaaatgccttctggagccagacgaactctatgacattgcaatcatcggagcgcca
tttgacacagcggtcacatacagacccggtgcgcgatttggccctcgggccattcgcgct
gccagcagtcgccaagtgccgggattggcatacaacacccgcgcagggataaacccctat
ctcagctgggcccgaatcctggactgtggtgacatccccgtcgttccattcgacaacgct
attgccgaatcgcaaatgtacgaagccttcctcgagcttggtagccgaccaacgccaaag
aatggcaaacccaaactcatcaccttaggaggtgatcacagcatcgcgcttccagcgctt
cgcgccttgtacaagatttataacaagccgattacggtggtgcatttcgacgcccacctc
gacacatggaatacactccggtactcggaggtgtggacttctgagcaatcccgcttcact
cacggcagttttttttacactgctagtcttgaagggcttatttccaatactagttccgtg
cacgcgggactccgaactcgtctgacgggtactgacgatggcgactacaccaatcagggt
ccggaacaaggcttcatgcgaattcacgctgacgacattgatgatatcggcgtaaagggg
gtgattgacgcaatcatctctcgtgtcggtctcttgcccgacgagcctgtatatttgagc
ctcgatattgacgtcctcgaccccagcatcgcgccagggacagggacgcccgaaccgggg
ggttggacgacgcgagaattgattagaatcctccgcgggattgagaagctgaaccttgtt
ggagcagacatcgtggaagtatcacccacttacgacggacatggagaaggaacagctctc
gcagcggctcaaatggtctatgagttactggccagcatggtaaagttggaacttaaagaa
gaagccgaagtccaaacaactgtcagagataaagagcagcactttatgtttccacagcag
cagagtgatgaagggcttgaaattatagcgtaa

DBGET integrated database retrieval system