KEGG   Coccidioides immitis: CIMG_00787Help
Entry
CIMG_00787        CDS       T01114                                 

Definition
(RefSeq) agmatinase
  KO
K01480  
agmatinase [EC:3.5.3.11]
Organism
cim  Coccidioides immitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CIMG_00787
Enzymes [BR:cim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CIMG_00787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 396 aa AA seqDB search
MRFSYWQGLLLGLLICWKPVAGHQDHQHGEQAPINEKDLLKKWGQEWAFSGISTFAHLKH
VKCLLEPDELYDIAIIGAPFDTAVTYRPGARFGPRAIRAASSRQVPGLAYNTRAGINPYL
SWARILDCGDIPVVPFDNAIAESQMYEAFLELGSRPTPKNGKPKLITLGGDHSIALPALR
ALYKIYNKPITVVHFDAHLDTWNTLRYSEVWTSEQSRFTHGSFFYTASLEGLISNTSSVH
AGLRTRLTGTDDGDYTNQGPEQGFMRIHADDIDDIGVKGVIDAIISRVGLLPDEPVYLSL
DIDVLDPSIAPGTGTPEPGGWTTRELIRILRGIEKLNLVGADIVEVSPTYDGHGEGTALA
AAQMVYELLASMVKLELKEEAGGWYGKKSQKSRDEL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttcatactggcagggactcctcctggggctattaatctgttggaagcccgtc
gctggccatcaggaccaccagcatggcgagcaggcgccaattaatgaaaaggacctgctc
aagaaatgggggcaggaatgggcgttctcgggcatttccacctttgcgcacctcaaacat
gttaaatgccttctggagccagacgaactctatgacattgcaatcatcggagcgccattt
gacacagcggtcacatacagacccggtgcgcgatttggccctcgggccattcgcgctgcc
agcagtcgccaagtgccgggattggcatacaacacccgcgcagggataaacccctatctc
agctgggcccgaatcctggactgtggtgacatccccgtcgttccattcgacaacgctatt
gccgaatcgcaaatgtacgaagccttcctcgagcttggtagccgaccaacgccaaagaat
ggcaaacccaaactcatcaccttaggaggtgatcacagcatcgcgcttccagcgcttcgc
gccttgtacaagatttataacaagccgattacggtggtgcatttcgacgcccacctcgac
acatggaatacactccggtactcggaggtgtggacttctgagcaatcccgcttcactcac
ggcagttttttttacactgctagtcttgaagggcttatttccaatactagttccgtgcac
gcgggactccgaactcgtctgacgggtactgacgatggcgactacaccaatcagggtccg
gaacaaggcttcatgcgaattcacgctgacgacattgatgatatcggcgtaaagggggtg
attgacgcaatcatctctcgtgtcggtctcttgcccgacgagcctgtatatttgagcctc
gatattgacgtcctcgaccccagcatcgcgccagggacagggacgcccgaaccggggggt
tggacgacgcgagaattgattagaatcctccgcgggattgagaagctgaaccttgttgga
gcagacatcgtggaagtatcacccacttacgacggacatggagaaggaacagctctcgca
gcggctcaaatggtctatgagttactggccagcatggtaaagttggaacttaaagaagaa
gccggtgggtggtatggcaagaagagtcagaaatctcgcgacgagctgtga

DBGET integrated database retrieval system