KEGG   Coccidioides immitis: CIMG_00827Help
Entry
CIMG_00827        CDS       T01114                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
cim  Coccidioides immitis
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CIMG_00827
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIMG_00827
   00640 Propanoate metabolism
    CIMG_00827
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CIMG_00827
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CIMG_00827
Enzymes [BR:cim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CIMG_00827
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CIMG_00827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2287 aa AA seqDB search
MPEITNGHGSSYAAKHNIPSHFIGGNSLEVAPPGAVKDFVAQHDGHSVITSVLIANNGIA
AVKEIRSVRKWAYDTFGDERAIQFTVMATPEDLQANADYIRMADRYVEVPGGTNNNNFAN
VELIVDVAERTGVHAVWAGWGHASENPKLPESLAASPKKIIFIGPPGSAMRSLGDKISST
IVAQHAGVPCIPWSGSGVDEVTIDDNGIVTVEDDIYDRGCTHSPQEGLEKARAIGFPVMV
KASEGGGGKGIRKVEREEDFVNLYNAAASEIPGSPIFIMKLAGNARHLEVQLLADQYGNN
ISLFGRDCSVQRRHQKIIEEAPVTIAKSSTFQAMERAAVRLGKLVGYVSTGTVEYLYSHA
DDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDVNTSSE
IDFDFSNEESLKAQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFS
VGTSGGIHNFSDSQFGHIFAYGENRSASRKHMVMALKELSIRGDFRTTVEYLIKLLETPA
FEDNTITTGWLDELITKKLTAERPDSVIAVICGAVTKAHVASEACIAEYKKGLEKGQVPS
KDVLKTVFTIDFIYEDVRYKFTATRASLDSYHLFINGSKCLVGVRALADGGLLVLLNGRS
HNVYWKDEAAATRLSVDGKTCLLEQENDPTQLRTPSPGKLVHYTVENGAHVKSGEVFAGI
EVMKLYMPLVAQEDGVVQFIKQPGATLQAGDILGILTLDDPSKVKHAQPFLGQMPDMGLP
QVVGSKPPQRFRLLHNILQDILLGFDNQVIMSGTLAELVEVLRDPDLPYGEWNAHVSALH
SRMPQKLDAQLTQVIEKSKARKADFPAAQLMKTFTRFLDENVAPADVEILKATLAPLVQV
IQDYTEGLRAHEYNVIAALLEQYWNVEHLFAQRNIRDEDAILKLRDEHKDDIMNVIQTVI
SHTKVGGKNNLVLAILETYRPNKPTTPNVGKYLKPILKKLAELESRPCSKVALKARELLI
QCALPSLEERMAQMEHILRSSVVQSKYGETGWDHREPDLDVLKEVVDSKYTVFDVLPLFF
GHQDQWVSLAALEVYVRRAYRAYDLQGVQYHNDQEIPFFISWDFVLRKVPQAEFGMNTAL
SNPSVPSTPTTENNPFKKISSISDMSYLVNKGANEPVRKGVLIPAQYFDEIEEVLSRALE
VFPRADRVQRPGSNNALELAAKRKPQPRPENDELVGVCNIAIRDMEGLDDKEVAARLSKI
VSDFKDDLQSRCVRRITFVCGHGDGTYPGYFTFRGPAYDEDESIRHSEPALAFQLELGRL
SKFNISPVFTENRNIHVYEAIGKGPAKEATADKRYFTRAVVRPGRLRDDIPTAEYLISEA
DNLMNDILDALEIIGNNNSDLNHIFINFTPVFQLQPSDVEQALAGFLERFGRRLWRLRVT
GAEIRILCTDPTTGMAYPLRVVITNTSGYIIQVEMYVERKSEKGEWVFHSIGGTTKVGSM
HLRPVTTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNAWIDAIASQPSLAEKRP
PQGGCIDYSELVLDDSDNLVEVSREPGTNTHGMVGWIVTARTPEYPHGRRFIVVANDITY
QIGSFGPLEDKFFHKCTELARKLGVPRIYLSANSGARIGMAEELMPLFSVAWNDPKKPEA
GFKYLYLTPEVKKKLDERKSKDVITELVHEDGEDRYKITTIIGAKDGLGVECLRGSGLIA
GATSRAYEDIFTITLVTCRSVGIGAYLVRLGNRAIQVEGQPIILTGAPAINKLLGREVYT
SNLQLGGTQIMYKNGVSHMTANDDFEGVQKIVQWMSFIPDRKGSPIPIRPSSDPWDRDIT
YYPPKQTYDVRWLIGGKEDEEGYLSGLFDKGTFQETLGGWARTVVVGRARLGGIPMGVIA
VETRSVDNITPADPANPDSMEMVTTEAGGVWYPNSAFKTAQALKDFNFGEQLPVMILANW
RGFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVIDPTINPDQME
MYADEESRGGVLEPEGIVGIKYRREKQLETMARLDPIYGELRRSFQDASLSAEQLSEIKN
KMTERENQLLPVYLQIALQFADLHDRAGRMEAKGTIRKPLQWKNARRFFYWRLRRRLSEE
LILKRMASVSAESQVGSPESSRSPSPTSSPGPAKPTLREKNLLMLRSWTGLLDKEFEDED
RKVALWYEENKKVLYEKVESMKTNSVAMQVAQLLMGDKEGGLKGVQQVLSMLPLEEKESV
LKYLSSS
NT seq 6864 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagatcacgaacggtcatggcagctcatatgctgcaaagcataatatcccatca
catttcatcggcggtaacagcttagaggtagcgccaccgggggctgtcaaggactttgtt
gctcagcacgatggtcactccgtcattacctcagtcttgattgcaaacaacggcattgct
gccgtcaaggagatcagatcggtccggaaatgggcctatgacacattcggtgatgaacgc
gcaattcaattcacagtgatggcaaccccggaggaccttcaggcgaatgcggactatatc
cgcatggccgatagatatgtggaagttcccggaggtaccaataacaacaactttgctaat
gtcgagctcattgtcgatgttgcggagagaacaggagttcatgcagtctgggccggctgg
ggacatgcttcggaaaatccaaaactgccagaatcgttagccgcctctcctaagaagatt
atcttcattggcccgccaggatcagccatgagatcccttggtgacaagatctcttctacc
atcgttgcacaacatgccggagtcccgtgcattccatggtccggttcgggagttgacgag
gttacgattgacgacaatggcattgttaccgtcgaagatgacatctacgatcgaggatgc
acacattctcctcaggaaggcttagaaaaagccagagctatcggctttccagtgatggtt
aaagcgtccgaaggtggcggcggaaaaggtattcgcaaagtggaaagggaggaggatttc
gtcaatctctacaacgccgctgccagtgaaattcccggttcgcccatttttatcatgaaa
cttgctgggaatgccaggcatctagaggtccaattgctggccgatcagtatggaaataat
atttcccttttcggaagagactgctccgtccagcgccgtcaccaaaagatcatcgaagag
gcacctgtcacgattgcgaaatcttctactttccaggcgatggaacgcgccgccgtgaga
ctcggcaaactcgtcggatatgtctcgactggtactgtggaatacttgtattcccatgcc
gatgacaagttctacttcctagagctaaaccctcgtctccaagtcgaacatccaaccact
gagatggtcactggtgttaatttgccagctgctcagcttcaaattgccatgggtattccc
ttacaccgtatcagagatattcgccttctctatggtgtcgatgtcaataccagttccgag
atcgattttgatttctcgaatgaggaaagtctcaaggctcagcggcgtcctcagccaaag
ggacacacaacggcctgtcgtattacttctgaggatcctggcgaaggctttaagccgtcc
agtggtacgatgcacgagctcaacttccgaagcagctctaacgtatggggttatttttcc
gttggaacttctggtggaattcataacttctctgattcccaattcggccacatttttgcc
tatggagaaaatcgatccgcgtcaaggaaacatatggttatggccttgaaggaactgagc
attcgtggtgactttagaacgaccgtcgagtatttaatcaaactcctggaaacgcctgcc
tttgaagataacacaattactactggctggcttgatgaacttatcactaagaagctaaca
gctgagcgcccggactccgtgattgctgttatttgtggagctgtgaccaaagcccatgtc
gcgagtgaagcctgcattgcagagtacaaaaagggtctcgaaaagggtcaagttccttcg
aaagatgtcctaaagactgtattcacgatcgattttatctacgaagacgtccgatacaag
tttaccgcaactagagcaagcttagacagctatcatctatttatcaacggatcaaaatgc
ttggttggcgtccgtgctcttgccgacgggggtttgcttgttttgttgaatgggcgaagt
cacaacgtgtactggaaagacgaagctgctgctacacgcttaagtgtcgatggcaaaact
tgtctcctggaacaagaaaatgatcccacacagcttagaacccccagcccaggtaagctg
gtgcattatacggtagaaaatggggcgcatgtcaaatccggtgaagtctttgctggaatc
gaggttatgaagttgtacatgcccttggttgcgcaagaagatggcgttgtccaattcatc
aaacagcctggtgctaccttgcaggctggtgatattctcggaatcctcacattggatgat
ccatccaaggtgaaacatgcacagccattcctcgggcagatgccagatatgggtcttcct
caagtcgtaggcagcaaacctccgcagagattccggcttcttcacaatatcttgcaagac
atccttctcggcttcgataaccaggtgatcatgtctggtacgcttgcagagttggtcgag
gtgctgagagacccggatttgccatatggtgaatggaacgcgcatgtttccgctcttcat
tcccggatgccgcaaaaacttgacgcgcagcttactcaggttatcgaaaagtccaaggcc
cgaaaggccgacttccctgctgcccagttgatgaagaccttcactcgcttcttggatgaa
aacgtggctcctgccgatgttgagatcctcaaggctacgcttgctcctctggttcaagta
atccaggactacactgaaggcttgagagctcatgagtacaatgtgatcgctgccctgttg
gagcaatattggaatgtggaacacctcttcgcccagagaaacatccgtgatgaagacgcg
atcctgaagcttcgagatgaacacaaggatgacattatgaatgtaattcaaaccgttatc
tcccacaccaaagttggcggaaagaataacttggtattggcaattcttgagacataccgg
ccaaacaaaccgactacgccaaatgttgggaaatatttgaaaccgatattgaaaaaattg
gcggaacttgaatcaaggccttgttccaaggttgcactcaaagcacgcgaacttctcatt
caatgtgctctaccgtcgttggaagagcgtatggctcagatggagcacatcctacgatct
tccgtcgttcagtcgaagtacggagaaacaggatgggaccacagggaaccagatctcgat
gtccttaaggaagttgtcgactcaaagtataccgtttttgatgtccttcctctgttcttt
ggccaccaggaccagtgggtatcgttggctgctttggaggtctacgttcgtcgggcttac
cgagcttacgacctccaaggcgttcaatatcataatgaccaggagattccattcttcatt
tcttgggatttcgttctgcgaaaggtacctcaggcagagttcgggatgaataccgcactt
tcaaacccctctgttccgagcaccccaacgacagaaaacaatccgtttaagaaaatcagt
tccataagcgatatgtcgtatttggtcaataagggtgcaaatgagccggtgcgaaaaggt
gtgctcattcctgcccagtacttcgatgagatcgaagaggtactctctcgagctctagag
gtattccctcgtgccgaccgtgtccagaggccgggctccaacaacgccctcgagctagct
gccaagagaaaacctcagccacgccccgaaaatgacgaactggttggagtttgtaacatc
gctattcgcgacatggaaggactagacgacaaggaagttgctgcccgtctcagcaagatt
gtgtctgacttcaaggatgatctgcagtctcgttgcgtccgcagaataacattcgtctgt
gggcatggcgacgggacctaccccggatacttcaccttcaggggccctgcatacgacgaa
gatgaaagcattcgccacagcgaacctgcattggctttccagctagaactcggccgactg
tccaaattcaacatcagtcctgtgtttaccgaaaacaggaatatccatgtttatgaagca
atcggtaaaggacctgccaaagaggccaccgctgacaagcgttacttcacccgtgctgtc
gtacgaccaggccgtttacgcgatgatatccccactgctgaatacctgatctccgaagcc
gataacctcatgaacgacattttggatgccctggagatcattgggaacaataactccgac
ttgaaccacattttcattaacttcacccctgtcttccaactgcagccatcggatgtggaa
caagctcttgcaggtttcttggagcgcttcggccggcgactttggcgcctgcgcgtaacc
ggagcagaaattcgaattctctgtactgaccctaccactggcatggcatatcctctccgt
gtagtgattacgaatacatccggctatatcatccaagttgagatgtacgtggaaagaaaa
tcggagaagggagagtgggtgtttcacagcattggtggtaccaccaaggttggatctatg
caccttcggccggtcacgacgccataccccacaaaagagtggcttcagcctaaacgttac
aaagctcatctgatgggaacgcaatacgtctatgatttcccagaactgttcagacaagct
ttccagaatgcctggatcgacgctatagccagccagcccagccttgctgaaaaacgacct
ccccagggtggttgtattgattacagtgagcttgtcctcgacgattctgataacttggtt
gaagtgtcacgagagcccggaaccaatacccatggtatggttgggtggatcgtcacagcc
agaactccggaatatcctcatggcaggcgcttcatcgttgttgccaacgatatcacctat
caaattggctcgttcggaccattggaagataaattcttccacaaatgtactgaactcgct
aggaaattaggtgttccgcgaatttacctgtctgccaactcgggtgctcgtatcggcatg
gcggaagaattgatgccactcttctctgttgcttggaacgatcccaagaagccggaggct
ggcttcaagtatctctacctgactccagaagttaagaagaagctggatgagcgaaagtcg
aaagatgtcatcaccgaacttgtccatgaagacggtgaagatagatacaagattacaact
atcatcggcgccaaggatgggttgggtgtcgagtgcctgagaggttctggtcttatcgcc
ggagctacatcgagagcctacgaagatattttcacgatcactctcgtgacttgccgctcc
gttggtatcggtgcttatctcgttcgtctcggtaaccgtgctatccaggttgaaggacaa
cccattattctaacaggtgctcctgccatcaataaacttcttggtcgagaagtctatacg
tccaatctgcaacttggtgggacgcaaattatgtacaagaatggcgtttctcatatgacc
gccaacgacgattttgaaggtgtccagaagattgtccagtggatgtccttcattcctgat
cgcaagggctcgccaattccaattcgaccaagctcggatccatgggatcgtgacattacc
tactacccacctaaacaaacgtatgatgtgcgatggctcattggtggtaaggaggacgaa
gaaggctatctctccggtctcttcgacaagggcacgttccaagaaactctcggaggctgg
gctaggacagtggtggtcggccgtgcgagacttggtggaattccaatgggtgtcattgct
gtcgaaactcgttccgtggataatattactccggcggatcctgctaatccggattctatg
gaaatggtcacaactgaagctggcggcgtgtggtaccccaactccgctttcaagactgct
caagctttgaaggactttaacttcggtgaacaacttccagtcatgatcctggccaactgg
cgtggtttctctggtggccagcgcgacatgtacaacgaggtcttgaaatacggttcctac
attgtcgatgctcttgtaaagtatgagcagcctatcttcgtttatatcccaccatttggc
gaacttcgtggtggctcatgggtcgttatcgatcctaccatcaaccctgatcaaatggag
atgtacgccgatgaagaatcgcgtggtggtgtcctcgaacctgagggtatcgtcggcatc
aagtatcgtcgcgagaaacagctagaaaccatggctcgtctcgacccgatttatggagaa
cttaggcggtcgtttcaggacgcgtcactgagtgccgaacaattatccgaaatcaagaac
aagatgactgagcgtgaaaaccaactccttccggtttatcttcaaattgctctccagttt
gccgatctacacgatcgtgccggtcgcatggaggcgaagggaaccatccgcaaaccgctt
cagtggaagaacgcgcgacgatttttctattggcgtctccgtcgccgtctcagcgaggaa
ctcattctcaagcgtatggcatctgtcagtgctgaatcccaagttggaagcccagaatcg
tcgagaagcccgtctcctacctcctcacccgggccagcgaagccaactctgcgtgagaag
aatcttctcatgctcaggtcttggactggcttactagacaaggaattcgaggatgaggac
cgcaaggttgctctttggtacgaggagaacaagaaggtcttatacgagaaggttgaatcc
atgaagaccaatagtgttgcaatgcaggttgcacagttattgatgggcgacaaggagggt
ggtctgaagggagtgcagcaggtgttgagcatgctgccactcgaggagaaagaatccgtt
ttgaaatacttgagcagctcttaa

DBGET integrated database retrieval system