KEGG   Coccidioides immitis: CIMG_00833Help
Entry
CIMG_00833        CDS       T01114                                 

Definition
protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cim  Coccidioides immitis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CIMG_00833
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CIMG_00833
   04113 Meiosis - yeast
    CIMG_00833
Protein phosphatases and associated proteins [BR:cim01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CIMG_00833
Ubiquitin system [BR:cim04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CIMG_00833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 808 aa AA seqDB search
MPPSAPHISNQLRQLVYYHLDNNLIRNALFVAGRLHAFEPRSSEAAYLLSLCHLLAGQSK
AAWEVSRNSGSRGTHLGCSYIYAQACLDLGKYIEGITALERSRPHWISRNNWNKHSESRR
QHLPDAAAVQCLQGRLWKAHKDIHKAVDCYVEALKLNPFLWDAFLGLCEAGASVRIPNIY
KMTPEMIAVLTASPSAENLASFDKDLPATGPLQVQPHSNNNVDPFISLNPRAETTGSSAL
WEKLNGNSMNVISGSEGMETPIAQSDSDDFRTNGGGGMGSESFGEPPLAPARKQRSMQVL
GLDLDPPPKMKSTVSRMKTRSRAEAEEGVSTREAPVPLVSERKRTVSGHIAPSSSTQLTE
PGAPQRRSVRLFNQIRPSASKISASASGLGTKEGRDIKKVKSTGVKTRSASGSTTTRVAS
GSRKAVTEPMDIDRKESAHGNQSKASPPDKSKEIEAIGWILELFSKLATGFNMLSNYRCQ
EAIQIFSSLPQSQRETPWVLSQLGRAYYEQAQYGEAEKYFIRVRTIAPHSLEDMEVYSTV
LWHLKNAVELAYLAHELMEVDRLSPQAWCAIGNSFSLEGDHDQALKCFQRATQVDPRFAY
AFTLQGHEYLSNEEHDKAMDAYRHAIGADNRHYNAWYGLGKVYEKMGKFKFAEQHYRTAS
NINPTNVVLICCIGLVLERMGNQKGALLQYARGCTLSPQAVVPRLRKARTLLKLHEVKHA
HAELKILKDIAPDEPNVHYLLGKFYKMMHDKSNAIKHFTTALNLDPKVSRSVEVSMKKTL
KLTVGFRPPSLSKMPWSRWIAPMISMMI
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgcccccttcagcaccccatatctccaaccagctacggcaattggtctactatcacctt
gacaacaaccttattcgaaacgccctttttgtcgctggccgcctacatgcattcgaaccg
agatcttcggaagcggcctacttactatccctttgtcaccttctagccggccagtcaaaa
gcagcgtgggaagtcagcaggaattctggctccagaggtacacatcttggatgctcatac
atatacgcccaagcatgccttgaccttggaaagtatatcgaaggaatcacagctttggag
cgcagcaggccacactggatttcaaggaataattggaataaacacagtgaaagtcgtcgc
cagcatctacccgacgccgccgcggttcagtgtctccagggacggctgtggaaagctcac
aaagatatacataaggctgtagattgctacgtcgaagccctgaaattaaatccttttctt
tgggacgcttttcttggcctctgcgaagcaggagcaagcgttcgaattcccaatatttat
aaaatgacgccggagatgatagccgttttaacggcttctccatcagctgagaatcttgcg
tcttttgataaagatttaccagcaactggtccgctgcaggtacagccgcattcgaataac
aacgttgatccgtttatttctctcaatcctcgggcggaaacaaccggaagctctgcgctg
tgggaaaagttgaacggaaactccatgaatgtcatctcaggcagcgaaggcatggaaacg
cctattgctcaaagcgattctgacgacttccgaaccaatgggggtgggggaatgggatct
gaatcttttggggaaccgccacttgcgccggcacggaagcagcggtccatgcaggtcctg
ggcctcgaccttgatccacctcccaagatgaaatccactgtctcgagaatgaaaactcgc
tctcgtgctgaagccgaagaaggggtttctactcgagaagccccggtacccctcgtttcc
gagcgtaagagaacagtatctggacacatcgcaccgagttcatctacgcaattaaccgag
cccggggccccgcagcgaaggagtgtccgattattcaaccaaattcgcccaagtgcaagt
aagatttctgcttcggcgagtggtctcggaacaaaggaaggccgcgatattaaaaaggtc
aagtccaccggtgtaaaaactcgaagtgcttccggttcaactacgacgagagttgctagc
ggtagccgtaaagcggtcacagagcctatggatatcgacaggaaggaaagcgcccatggt
aatcagagtaaggcttcgcctcccgacaaatcaaaagagattgaggctataggctggatt
ctagaactattctcgaagcttgctactggtttcaacatgttgtcgaattatcgatgccag
gaagctatccaaatttttagttccttacctcaaagccagagagaaacgccgtgggtcctg
tcacaacttggacgtgcatattatgagcaagcgcaatacggcgaagcggagaaatacttc
attcgagttcggaccattgcaccacacagtttggaggatatggaggtctattcaacggtc
ctctggcatctcaaaaatgccgttgaactagcatacctcgcgcatgagctcatggaagtt
gatcggctatcgccacaggcatggtgcgcgataggaaattcgttttctctggaaggtgac
cacgaccaagccctgaagtgttttcagcgtgccacgcaggttgacccacggtttgcgtac
gcctttactttgcaaggacatgagtatctttccaatgaagagcacgacaaagcgatggat
gcttatcggcatgcgattggcgctgacaacaggcattataatgcctggtatggattgggc
aaggtctatgaaaagatgggcaaattcaagtttgcagagcagcattatcgaacggcgtcg
aacatcaatccaactaatgtcgtgctaatctgctgtattggcctagtgttggaacggatg
ggaaaccagaagggcgcgttgctgcagtatgctcgaggctgcactctgtcaccacaggcg
gttgttccacggttgcgcaaggctcggactctgttgaaacttcatgaagtcaaacacgct
cacgcagaattaaaaatcttgaaggatattgcacccgatgagcctaatgtccattatctt
ctcggcaagttctacaaaatgatgcatgataaaagcaatgcgattaagcatttcacaact
gccttgaacttggatccaaaggtatccagaagcgttgaagtgtctatgaagaagactttg
aaactaaccgttggctttaggccgcccagtttatcaaagatgccatggagtcgttggata
gccccgatgatttcgatgatgatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system