KEGG   Coccidioides immitis: CIMG_00843Help
Entry
CIMG_00843        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cim  Coccidioides immitis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CIMG_00843
Enzymes [BR:cim01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CIMG_00843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 624 aa AA seqDB search
MAPTPPPKQKGKLTLAQLAAYDDIVTDALVDRAFFWTKIRKNRPKYFAVRGVVEDDVTSI
LLHDVIVAKDVIKAEKSLLNLSGLRKYVETLKSDKEKEWFRRHLRKYIAIYLPDCPFEVT
TTNRYTITTHEAALSARKFIRTGDTIKHLSGTLVAITPEEEKTLDLTRRDFSIVMSSRKK
TPSLFLGPARFSNHDCNPNARLVTKGSEGMEIVAIRDISIGEEITVSYGENYFGVDNCEC
LCHTCELSLSNGWSPGGPPEHDSRASTPETTEHQEKSSSGSEKRKSPPESPSHPSEDMPS
KRPKFENILNLRLEISPPSSPDPIAEPLITVNGGLRALRSHFASLAGKSDLRHFQKPHSN
FISASSSSDQTSCSLCPDDEAPTSTRSTSATSISDSNVQVKTEPTVEQQPRASSETAPKT
ISGDHGLHVQDIIRDNDESDLSDLSASWEINDREMTAVKREPVKKKKRKRKSSIIPTIEH
EAPKARTPGDYTKTPKLLAQRYDRWVDCQTCNAWFVQGDAYLTRKECPRCERHSKLYGYR
WPKTDREGRNDTEERVMDHRTIHRFLRTEDEARVQRRGRGVSHATSPTPDVSENKTETDA
SEFGDERRLTRSLRRARSSLRLAI
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcacctactccaccgccaaagcagaaaggaaagttgacccttgctcagcttgcggct
tacgatgacattgtcaccgacgcgttggtcgatcgcgcgtttttctggaccaagattcgt
aagaaccgacccaaatactttgccgttcggggggttgtggaggacgatgtcacctcgata
ttgctgcacgacgttatcgtcgccaaagacgtgataaaggcggaaaagtcattgctgaat
ctctcgggcctcagaaaatatgttgagacgctcaaatctgacaaggagaaggaatggttc
cgtcgccaccttcgaaaatatattgcaatttacctccccgactgccctttcgaagtcacg
actacgaaccgctacaccatcactacccatgaggctgcgctgtcagccaggaaatttata
cgcactggtgacactattaagcatctttcggggaccctcgtcgcaattacccctgaggag
gaaaagaccctcgacctgacaaggcgagatttcagtattgtcatgtcaagtaggaaaaag
acaccatcgcttttccttggaccagcgagattctcgaatcatgactgcaatcccaacgct
cggctggttacaaagggctcagaaggcatggaaatcgtggccattagggacatatccatc
ggcgaagagattactgtatcatacggggaaaattacttcggggtagataattgcgaatgc
ctctgccatacttgcgaactttccctgagcaatggatggtccccaggtggcccgccggaa
cacgatagtcgtgcctccacaccagaaacaactgaacaccaggagaaaagttcctcaggc
tccgagaagagaaaaagccctcccgaatctccttcacacccgtcagaagatatgccttca
aaaaggcctaagttcgaaaacatattaaatctacgactagaaatttcccctccaagcagc
cctgaccctattgctgagcctttgatcacggttaacggcggcttacgtgcgttgagaagt
cacttcgcttcgttggccggtaaatctgacctacgacactttcagaaaccccattcgaat
ttcatctcagcctcgtcttcgagcgaccaaacttcctgcagtttatgtccggatgacgag
gcacctacttccacgaggtcaacatcagccacatcgatcagcgattcaaatgtgcaggta
aaaactgaacctacagtggagcagcaacccagggcctcatctgaaaccgcccccaagacc
atttcgggagatcatggtttacacgttcaagacattatccgagataatgatgaatcggac
ttatcagacctctctgcatcgtgggaaatcaatgaccgtgaaatgacagctgtcaagcga
gagcctgttaagaagaagaagaggaaacgaaaaagtagcattatccccactattgaacat
gaagccccaaaagcgcgaacgccgggcgattatacgaaaactccaaagctccttgcacag
cggtatgaccgctgggtggattgccagacgtgtaatgcttggtttgtccaaggagacgcc
tatctcactcggaaagaatgtccacgatgcgaacgacattccaagctatatggctatcgt
tggcctaaaaccgacagggaaggtcggaatgatactgaggagcgtgtgatggatcatcgc
actatccaccggttcttgaggacggaagatgaagcgcgtgttcagcgccgaggccgtggt
gtcagccatgcaaccagtccgacgccggacgtttctgagaacaagacagaaacggatgca
agcgagttcggcgacgaaagacgacttacaaggtcactgaggcgtgcgaggagttcttta
cgtctagcaatatga

DBGET integrated database retrieval system