KEGG   Coccidioides immitis: CIMG_00954Help
Entry
CIMG_00954        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cim  Coccidioides immitis
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CIMG_00954
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CIMG_00954
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CIMG_00954
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CIMG_00954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 435 aa AA seqDB search
MKGTSKALTIVIKLGTSSIVDEHTREPILSILTLIVEMATKLHKDGHRVIIVSSGAVGVG
LRKMDIEQRPKHLPCIQLMGIWDSLFAHLRQPIAQILLTRNDIADRTQYINAQNTFDELL
KMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVQADYLFLLTDVDGLYTSNPRTNPDA
EVIEVVDDISSLEADVSTAGSSLGTGGMSTKIVAARLATSAGVTTVITRSSRPGNISEII
DYLESSKRSLALIEGEPMAQPPLYTPPLHTRFLPSTTPMQSRSFWILHGITPHGTIYIDH
GAYCAILNNASLLPAGVVAVEGHFSQQEAVRVVVVERRSPSALNGDFPLNGEEPKEAGRA
LVNYGSAEIARIKGLRSTQIRTVLGYADSEYIALRENISFFHMSDRPSRPGTPGLDEFMV
RSGAQSPVIDKVVAA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaacctcgaaggcattgaccattgtgataaagctcgggacgagttcaattgtg
gatgagcatacccgtgagccgattctttcgatccttactctgatcgtggagatggcgacc
aaacttcataaagatggccatcgagtcattatcgtctcgtctggagcggtcggcgttggg
ctacgcaaaatggacattgagcagagaccaaaacacttgccctgtattcagttgatgggt
atatgggatagtcttttcgctcatcttcgccagcccattgcccaaatattgttgacaaga
aacgatattgcggataggacccaatatattaatgctcaaaatacctttgatgaattgcta
aaaatgggcgtgattcctattgtgaacgagaatgatacccttgctgtttcggaaataaaa
tttggagataacgataccctttctgcgattacagctgcgatggtccaagcggattactta
ttccttttgactgatgtcgatggcctatacacttctaacccgcgaaccaaccccgatgcc
gaggttatcgaagtggttgatgatatctcgtctcttgaagctgacgtttcgacagccgga
tcctccttaggcacggggggaatgagcaccaaaattgtggcagcccgactagctacaagt
gcaggtgtcacaaccgtcattacacgcagttctcggcctggaaacatttcggagattata
gattacctcgaaagctccaagcgctcgctggcccttatcgaaggagagccgatggctcag
cctcccctatatacccctccgttacacacccgtttcctcccttcgaccactccgatgcaa
tccagatcgttctggattctccatggaatcacacctcatggcacaatatatatcgaccat
ggtgcttactgcgctattttaaacaacgcaagccttcttccggccggcgtcgtggcagtc
gaggggcacttctcccaacaggaagcggtgcgggtcgtagtcgtcgagcggcgctcccca
tcggctctcaatggggatttccctctgaacggcgaggagccaaaggaagccggacgagcg
ctcgtaaattacggcagtgcggagatcgcccgtataaaggggttaagaagtacacaaata
cggacagttttgggctacgcagatagcgagtacattgcgttgcgcgagaatatttccttt
ttccacatgtcagatcgacctagtcggcccggtacgcccggtttggatgagttcatggtt
cgaagcggcgcgcagtctcctgtgatcgataaggtagtggcagcctag

DBGET integrated database retrieval system