KEGG   Coccidioides immitis: CIMG_00954Help
Entry
CIMG_00954        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cim  Coccidioides immitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cim01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cim00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 435 aa AA seqDB search
MKGTSKALTIVIKLGTSSIVDEHTREPILSILTLIVEMATKLHKDGHRVIIVSSGAVGVG
LRKMDIEQRPKHLPCIQLMGIWDSLFAHLRQPIAQILLTRNDIADRTQYINAQNTFDELL
KMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVQADYLFLLTDVDGLYTSNPRTNPDA
EVIEVVDDISSLEADVSTAGSSLGTGGMSTKIVAARLATSAGVTTVITRSSRPGNISEII
DYLESSKRSLALIEGEPMAQPPLYTPPLHTRFLPSTTPMQSRSFWILHGITPHGTIYIDH
GAYCAILNNASLLPAGVVAVEGHFSQQEAVRVVVVERRSPSALNGDFPLNGEEPKEAGRA
LVNYGSAEIARIKGLRSTQIRTVLGYADSEYIALRENISFFHMSDRPSRPGTPGLDEFMV
RSGAQSPVIDKVVAA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaacctcgaaggcattgaccattgtgataaagctcgggacgagttcaattgtg
gatgagcatacccgtgagccgattctttcgatccttactctgatcgtggagatggcgacc
aaacttcataaagatggccatcgagtcattatcgtctcgtctggagcggtcggcgttggg
ctacgcaaaatggacattgagcagagaccaaaacacttgccctgtattcagttgatgggt
atatgggatagtcttttcgctcatcttcgccagcccattgcccaaatattgttgacaaga
aacgatattgcggataggacccaatatattaatgctcaaaatacctttgatgaattgcta
aaaatgggcgtgattcctattgtgaacgagaatgatacccttgctgtttcggaaataaaa
tttggagataacgataccctttctgcgattacagctgcgatggtccaagcggattactta
ttccttttgactgatgtcgatggcctatacacttctaacccgcgaaccaaccccgatgcc
gaggttatcgaagtggttgatgatatctcgtctcttgaagctgacgtttcgacagccgga
tcctccttaggcacggggggaatgagcaccaaaattgtggcagcccgactagctacaagt
gcaggtgtcacaaccgtcattacacgcagttctcggcctggaaacatttcggagattata
gattacctcgaaagctccaagcgctcgctggcccttatcgaaggagagccgatggctcag
cctcccctatatacccctccgttacacacccgtttcctcccttcgaccactccgatgcaa
tccagatcgttctggattctccatggaatcacacctcatggcacaatatatatcgaccat
ggtgcttactgcgctattttaaacaacgcaagccttcttccggccggcgtcgtggcagtc
gaggggcacttctcccaacaggaagcggtgcgggtcgtagtcgtcgagcggcgctcccca
tcggctctcaatggggatttccctctgaacggcgaggagccaaaggaagccggacgagcg
ctcgtaaattacggcagtgcggagatcgcccgtataaaggggttaagaagtacacaaata
cggacagttttgggctacgcagatagcgagtacattgcgttgcgcgagaatatttccttt
ttccacatgtcagatcgacctagtcggcccggtacgcccggtttggatgagttcatggtt
cgaagcggcgcgcagtctcctgtgatcgataaggtagtggcagcctag

DBGET integrated database retrieval system