KEGG   Coccidioides immitis: CIMG_01104Help
Entry
CIMG_01104        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cim  Coccidioides immitis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cim00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:cim00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cim00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 604 aa AA seqDB search
MRFLLVSYFLLTAGSFVSAIWPEPAHYTHGDTVVLLDPSVRFTYQRGEFRVYDEGGSYFT
ASTDYGRLMRLLEPQWFGIGNLHPNSEKSVDDILKKAIKRTRKELRRTRFVPWKFHPRNQ
SFEPRSLRREEAIKEILIEEAPSDDEILSRDYISGDESYEIRITKKGKATILTASPIGTL
RALQTLPQLFYAHSSGGVYTPYAPISISDKPKWSHRGLNLDISRNPIGPNDVKRTIDAMA
SVKLNRLHIHATDSQSWPLDIPSLPSMAAKAAYHPGLVWSSSDLRNVQKYGLARGVSTFI
EIDMPGHTGSIGHAFPDLVVAFGNDSWDKYALEPPCGQVKLNDSAVRRFFDTVMADILPR
VSPFTAYFHTGGDEFNLQSYMLEETIRSNDPKVLKPLLQDFVNRVHMQIMEAGLTPIVWE
ELVLDWDLTFPSQQSETQGIIVQAWRNSTAVRQILEKGYRTIFGSGDAWYLDCGVGGFIN
PRPGSGAVKEPYLDWCSPTKNWRHIYTYNPLEGIPEELQSLLEGGETHMWAENVDPVNMD
QMIWPRAASAAEVLWSGPRARDDIMEASHRLGKWRERAVIDMGVGASMVQMTYCLMREGS
CELQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcctacttgtatcttactttctccttacagctggtagcttcgtctctgcgatt
tggccagaacctgcccactatacgcacggagacactgtggtattgctggatccgtcagtt
cgctttacctatcaacgtggggagttcagggtctatgatgagggtgggagctatttcact
gccagcacggactatggccgtctaatgagactgctagaaccgcaatggttcggtattggg
aatctccacccaaattcagagaagtcggtagatgatatcctcaagaaagccataaagcgc
accagaaaggagcttcggcgtaccagatttgtaccttggaaatttcatcctcgtaatcaa
tcgttcgagccacggtctctgaggcgagaggaagcgatcaaagagattttgatcgaagag
gcgccctcagacgatgagattttaagtcgtgactatataagcggagatgaaagctatgaa
atcaggatcactaagaaaggcaaggcgacgattttgacagcgtctccaattggaaccctc
cgcgcgcttcaaactcttccacaactgttctatgcccattcgtctggtggcgtatataca
ccgtatgccccaatttcaatctcagacaaaccaaaatggagccaccgaggtctaaacctc
gatatctcacgaaatcctatcggccctaatgatgtgaaaaggacaattgatgccatggca
tcggtaaagctgaaccggctgcacatccatgccactgattcccaatcgtggcctctggat
attccgtcgctgccgtcaatggcggctaaggctgcatatcatcctggacttgtctggtca
tcgtctgatctacgaaatgtgcaaaaatacgggttagcaaggggagtctctactttcatc
gaaattgacatgcctggccacacaggatccatagggcatgcgtttccggacctagttgtg
gctttcggtaatgacagctgggataaatatgccctagaacctccttgcggtcaggtgaaa
ctaaatgattcggctgttcgccgtttctttgataccgttatggccgatatcttacctcga
gtatctccattcaccgcatatttccatacaggaggagatgaattcaatctccagagctat
atgctcgaggagaccatacgttcaaatgacccaaaagtactcaagcctcttctccaggat
ttcgttaatcgcgtgcatatgcagatcatggaagctggactgacaccaatcgtttgggaa
gagcttgttctcgactgggaccttactttcccttcgcaacaatcagaaacccaggggatt
attgtacaggcctggcgaaactctacagcagtcagacaaatcctggagaaaggttaccgc
acgatctttggatcaggggatgcctggtatcttgactgcggagtaggagggtttatcaac
cctcggccgggatccggtgctgtcaaggagccatatcttgactggtgctcccccactaag
aactggcgacacatatacacatacaatccactagagggcatacccgaagagctgcagtcg
ctgctcgaagggggtgaaacgcacatgtgggcagagaacgtggatcctgtgaacatggac
cagatgatctggccacgagcagcctcggcagcggaggtgctctggagcggaccccgggcg
cgcgacgatatcatggaggcgtctcatcggcttggaaaatggagggagcgagcggtgatc
gacatgggggtcggggcgagcatggtgcagatgacgtattgccttatgcgcgagggcagt
tgcgaattacaatga

DBGET integrated database retrieval system