KEGG   Coccidioides immitis: CIMG_01104Help
Entry
CIMG_01104        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cim  Coccidioides immitis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CIMG_01104
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CIMG_01104
   00603 Glycosphingolipid biosynthesis - globo series
    CIMG_01104
   00604 Glycosphingolipid biosynthesis - ganglio series
    CIMG_01104
   00511 Other glycan degradation
    CIMG_01104
Enzymes [BR:cim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CIMG_01104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 604 aa AA seqDB search
MRFLLVSYFLLTAGSFVSAIWPEPAHYTHGDTVVLLDPSVRFTYQRGEFRVYDEGGSYFT
ASTDYGRLMRLLEPQWFGIGNLHPNSEKSVDDILKKAIKRTRKELRRTRFVPWKFHPRNQ
SFEPRSLRREEAIKEILIEEAPSDDEILSRDYISGDESYEIRITKKGKATILTASPIGTL
RALQTLPQLFYAHSSGGVYTPYAPISISDKPKWSHRGLNLDISRNPIGPNDVKRTIDAMA
SVKLNRLHIHATDSQSWPLDIPSLPSMAAKAAYHPGLVWSSSDLRNVQKYGLARGVSTFI
EIDMPGHTGSIGHAFPDLVVAFGNDSWDKYALEPPCGQVKLNDSAVRRFFDTVMADILPR
VSPFTAYFHTGGDEFNLQSYMLEETIRSNDPKVLKPLLQDFVNRVHMQIMEAGLTPIVWE
ELVLDWDLTFPSQQSETQGIIVQAWRNSTAVRQILEKGYRTIFGSGDAWYLDCGVGGFIN
PRPGSGAVKEPYLDWCSPTKNWRHIYTYNPLEGIPEELQSLLEGGETHMWAENVDPVNMD
QMIWPRAASAAEVLWSGPRARDDIMEASHRLGKWRERAVIDMGVGASMVQMTYCLMREGS
CELQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcctacttgtatcttactttctccttacagctggtagcttcgtctctgcgatt
tggccagaacctgcccactatacgcacggagacactgtggtattgctggatccgtcagtt
cgctttacctatcaacgtggggagttcagggtctatgatgagggtgggagctatttcact
gccagcacggactatggccgtctaatgagactgctagaaccgcaatggttcggtattggg
aatctccacccaaattcagagaagtcggtagatgatatcctcaagaaagccataaagcgc
accagaaaggagcttcggcgtaccagatttgtaccttggaaatttcatcctcgtaatcaa
tcgttcgagccacggtctctgaggcgagaggaagcgatcaaagagattttgatcgaagag
gcgccctcagacgatgagattttaagtcgtgactatataagcggagatgaaagctatgaa
atcaggatcactaagaaaggcaaggcgacgattttgacagcgtctccaattggaaccctc
cgcgcgcttcaaactcttccacaactgttctatgcccattcgtctggtggcgtatataca
ccgtatgccccaatttcaatctcagacaaaccaaaatggagccaccgaggtctaaacctc
gatatctcacgaaatcctatcggccctaatgatgtgaaaaggacaattgatgccatggca
tcggtaaagctgaaccggctgcacatccatgccactgattcccaatcgtggcctctggat
attccgtcgctgccgtcaatggcggctaaggctgcatatcatcctggacttgtctggtca
tcgtctgatctacgaaatgtgcaaaaatacgggttagcaaggggagtctctactttcatc
gaaattgacatgcctggccacacaggatccatagggcatgcgtttccggacctagttgtg
gctttcggtaatgacagctgggataaatatgccctagaacctccttgcggtcaggtgaaa
ctaaatgattcggctgttcgccgtttctttgataccgttatggccgatatcttacctcga
gtatctccattcaccgcatatttccatacaggaggagatgaattcaatctccagagctat
atgctcgaggagaccatacgttcaaatgacccaaaagtactcaagcctcttctccaggat
ttcgttaatcgcgtgcatatgcagatcatggaagctggactgacaccaatcgtttgggaa
gagcttgttctcgactgggaccttactttcccttcgcaacaatcagaaacccaggggatt
attgtacaggcctggcgaaactctacagcagtcagacaaatcctggagaaaggttaccgc
acgatctttggatcaggggatgcctggtatcttgactgcggagtaggagggtttatcaac
cctcggccgggatccggtgctgtcaaggagccatatcttgactggtgctcccccactaag
aactggcgacacatatacacatacaatccactagagggcatacccgaagagctgcagtcg
ctgctcgaagggggtgaaacgcacatgtgggcagagaacgtggatcctgtgaacatggac
cagatgatctggccacgagcagcctcggcagcggaggtgctctggagcggaccccgggcg
cgcgacgatatcatggaggcgtctcatcggcttggaaaatggagggagcgagcggtgatc
gacatgggggtcggggcgagcatggtgcagatgacgtattgccttatgcgcgagggcagt
tgcgaattacaatga

DBGET integrated database retrieval system