KEGG   Coccidioides immitis: CIMG_01106Help
Entry
CIMG_01106        CDS       T01114                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cim  Coccidioides immitis
Pathway
cim00860  Porphyrin and chlorophyll metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CIMG_01106
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CIMG_01106
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CIMG_01106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox Thi4 Pyr_redox_2 NAD_binding_9 MCRA NAD_Gly3P_dh_N FAD_binding_2 FAD_oxidored HI0933_like K_oxygenase Shikimate_DH ApbA Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 4566890
NCBI-ProteinID: XP_001247335
UniProt: J3KIF8
AA seq 582 aa AA seqDB search
MRSRCSSAHAVEELWTLAQAHRFSTRPRVVFSKHLRNRTRLNFSSTASNDTRNVAVIGGG
ITGLATAYHLAKDQSTKVTIWERSDRLGGWLDSERINVNIGGDVLFDYGPRTLRATASAF
STLELINEFGLEKQILRTGIHDAASRNRYIYYPDHLVRLPGPQPGAGLLVNLISNAIGVF
TEPALKSLPWALATEPLRPSRPKDLDDESVGDFVARRLGKDVADNIVSAVFHGIYAGDIY
KLSVKTILPRIWEYEISRRGIFGSLLNTKRTLHLPYDLYHEGKIIREEKGKEFLSKIGSY
ISGASVFALKGGMGQLVEALDTSLSNSPNVEIITGSSVDHIERRDTQWRIGAKDYNCVVS
TTSSAELRRQIAPILTNTGALVALESHNYAVNVMVVNFFFRSPNLVPVHGFGYLIPRSIP
LEQNPERALGVVFMSDSNVGQDTARGTKLTVMIGGHWWDGWRDGDFPDERSGIQMAKAVL
KRHLHINEEPIVAKAKLLKNAIPQYTVGHTARMKDLHFSLSHVAPGIRLAGAWYTGVGVN
DCTRAARLTAHSILSGKREETGLEKYLDENVAGYEVPLGSSG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgcgatgttcgtccgcccatgcagttgaagagctatggacgcttgctcaagcg
cacaggttttccaccaggccacgcgttgtattttcgaagcatttaaggaaccgaactcga
cttaatttctcatccacagctagcaatgacacaagaaatgtcgcagtaatcggtggtggc
attaccggccttgcaactgcttatcatcttgcaaaagaccaatcgactaaagtcacgatc
tgggagcgctcagatcgtctaggcggatggctggattctgagaggatcaacgtcaatatt
ggtggagatgtgcttttcgactatggacctcgcaccctccgtgctacggcgagtgcgttt
tccacgctcgaactgataaacgagttcggtctcgaaaagcagatccttcgtacgggcatt
catgacgctgcttcgcgcaaccgctacatttattacccagaccaccttgtccgcctacca
ggaccgcaacccggggccggcctgctcgtaaacctcatctccaatgctataggcgtgttt
acggaaccggcgttgaagagcttaccatgggcgctggcgaccgagcccttgagaccctct
cgtcccaaagatcttgatgacgaatccgtgggagatttcgtagctaggagattggggaaa
gacgttgctgataatatagtttccgctgtctttcatggtatctatgctggtgatatatat
aagctcagtgtcaagacaatattaccccgtatttgggagtatgaaatatcgaggcgtggc
atctttgggtcgttgctcaacactaagaggacgctacatctcccgtacgatctttaccac
gagggaaaaataatcagggaagagaaaggaaaagaatttcttagtaaaatcggctcctac
atctctggtgctagtgtctttgccttgaaaggggggatgggacagctggtcgaagccttg
gatacgtcgctttccaactctccaaacgttgagataattacaggttcaagtgtcgatcac
atagagcggcgtgatactcaatggcggattggagcgaaggactacaattgtgtcgtctcg
actacttcgtctgctgagctccgccgacaaatagctcccattctgacaaatactggagcc
ctcgtggcgcttgaaagtcataattacgccgttaacgtaatggttgtcaatttcttcttc
aggtctccaaacctggtgcccgtccacggtttcggttacttgattcctcgttctataccc
ctggaacaaaaccctgaacgtgccttgggtgttgtgtttatgtccgattccaacgtcggt
caagacacagcacggggtactaagctcaccgttatgataggaggccactggtgggacggg
tggagagacggggattttcccgatgagcggtcgggaattcaaatggccaaagcagtgctg
aagcgtcatctacatattaatgaggagccgattgttgccaaggcgaaactgctgaaaaat
gcaattccgcagtatacggttggacatactgctcggatgaaggacctgcatttttcactt
tcgcacgtggccccgggaataaggctggctggagcatggtacactggggttggagttaac
gattgcacacgagctgcaaggttgacagcccactcaatcctttcaggtaaacgtgaagag
acggggttggaaaaatatcttgatgaaaatgtagcaggttacgaagtgcctcttgggagc
tcgggctaa

DBGET integrated database retrieval system