KEGG   Coccidioides immitis: CIMG_01106Help
Entry
CIMG_01106        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cim  Coccidioides immitis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CIMG_01106
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CIMG_01106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 582 aa AA seqDB search
MRSRCSSAHAVEELWTLAQAHRFSTRPRVVFSKHLRNRTRLNFSSTASNDTRNVAVIGGG
ITGLATAYHLAKDQSTKVTIWERSDRLGGWLDSERINVNIGGDVLFDYGPRTLRATASAF
STLELINEFGLEKQILRTGIHDAASRNRYIYYPDHLVRLPGPQPGAGLLVNLISNAIGVF
TEPALKSLPWALATEPLRPSRPKDLDDESVGDFVARRLGKDVADNIVSAVFHGIYAGDIY
KLSVKTILPRIWEYEISRRGIFGSLLNTKRTLHLPYDLYHEGKIIREEKGKEFLSKIGSY
ISGASVFALKGGMGQLVEALDTSLSNSPNVEIITGSSVDHIERRDTQWRIGAKDYNCVVS
TTSSAELRRQIAPILTNTGALVALESHNYAVNVMVVNFFFRSPNLVPVHGFGYLIPRSIP
LEQNPERALGVVFMSDSNVGQDTARGTKLTVMIGGHWWDGWRDGDFPDERSGIQMAKAVL
KRHLHINEEPIVAKAKLLKNAIPQYTVGHTARMKDLHFSLSHVAPGIRLAGAWYTGVGVN
DCTRAARLTAHSILSGKREETGLEKYLDENVAGYEVPLGSSG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgcgatgttcgtccgcccatgcagttgaagagctatggacgcttgctcaagcg
cacaggttttccaccaggccacgcgttgtattttcgaagcatttaaggaaccgaactcga
cttaatttctcatccacagctagcaatgacacaagaaatgtcgcagtaatcggtggtggc
attaccggccttgcaactgcttatcatcttgcaaaagaccaatcgactaaagtcacgatc
tgggagcgctcagatcgtctaggcggatggctggattctgagaggatcaacgtcaatatt
ggtggagatgtgcttttcgactatggacctcgcaccctccgtgctacggcgagtgcgttt
tccacgctcgaactgataaacgagttcggtctcgaaaagcagatccttcgtacgggcatt
catgacgctgcttcgcgcaaccgctacatttattacccagaccaccttgtccgcctacca
ggaccgcaacccggggccggcctgctcgtaaacctcatctccaatgctataggcgtgttt
acggaaccggcgttgaagagcttaccatgggcgctggcgaccgagcccttgagaccctct
cgtcccaaagatcttgatgacgaatccgtgggagatttcgtagctaggagattggggaaa
gacgttgctgataatatagtttccgctgtctttcatggtatctatgctggtgatatatat
aagctcagtgtcaagacaatattaccccgtatttgggagtatgaaatatcgaggcgtggc
atctttgggtcgttgctcaacactaagaggacgctacatctcccgtacgatctttaccac
gagggaaaaataatcagggaagagaaaggaaaagaatttcttagtaaaatcggctcctac
atctctggtgctagtgtctttgccttgaaaggggggatgggacagctggtcgaagccttg
gatacgtcgctttccaactctccaaacgttgagataattacaggttcaagtgtcgatcac
atagagcggcgtgatactcaatggcggattggagcgaaggactacaattgtgtcgtctcg
actacttcgtctgctgagctccgccgacaaatagctcccattctgacaaatactggagcc
ctcgtggcgcttgaaagtcataattacgccgttaacgtaatggttgtcaatttcttcttc
aggtctccaaacctggtgcccgtccacggtttcggttacttgattcctcgttctataccc
ctggaacaaaaccctgaacgtgccttgggtgttgtgtttatgtccgattccaacgtcggt
caagacacagcacggggtactaagctcaccgttatgataggaggccactggtgggacggg
tggagagacggggattttcccgatgagcggtcgggaattcaaatggccaaagcagtgctg
aagcgtcatctacatattaatgaggagccgattgttgccaaggcgaaactgctgaaaaat
gcaattccgcagtatacggttggacatactgctcggatgaaggacctgcatttttcactt
tcgcacgtggccccgggaataaggctggctggagcatggtacactggggttggagttaac
gattgcacacgagctgcaaggttgacagcccactcaatcctttcaggtaaacgtgaagag
acggggttggaaaaatatcttgatgaaaatgtagcaggttacgaagtgcctcttgggagc
tcgggctaa

DBGET integrated database retrieval system