KEGG   Coccidioides immitis: CIMG_01227Help
Entry
CIMG_01227        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cim  Coccidioides immitis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cim00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CIMG_01227
Enzymes [BR:cim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CIMG_01227
Peptidases [BR:cim01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CIMG_01227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1017 aa AA seqDB search
MNRHHPRWAGQFSGLMMAVNSQHATMENIKRKLSSQHNPSYGHESSQSRPNSGGYNASPI
LPSESSRYEAAQDPRDIPIRMPSPSSFQCSPTIPAILQMPGSPSRKIKPEVKPKPENLMG
KPTEEKTTMRDPLTQRFAELRNSHIKRTPIDYSGTTLNNGTWAPPSADSHTSQPLSHSRP
RSALDPPPPRPLGPREMNSHRTDPPAPPPKVPISSVEPSLPRVPSPAYSPVTTVPSQPPP
NPPRTSVDSIRPVSCRQSSSWMGVSNETLTVVDDNPYRSRTPNGMNAEGELRNNTADMTV
GESISAEDLLQFLRKYDILLIDVRPRDQYDSGHIYSKSIICIEPVILKENMSAEELEDRL
VISPEAEQSLFSKRNEFDLIVYYDQNTSDPSYLSGSPASSAVPHLRALYDTLYEFNMYKP
LKYGRQPAFLVGGLDAWVDLVGQQSLSTTHTAAIMHSVRARKPVPGKYQPLRRMPTASAN
SSWEVKKRRLREFKPLNPEEERAWLEKAKTEEIDPSSYGAGDGVITEEPEDLESAEAELS
SSFVHSYEDFLRRFPEPGDIRQSMAGLPMTDHQSTQFHEPLIAHPSRPPPAVPRPSYSGV
TDGRHIQPSFARQASATKHALYKASSPLDRIKLPRTGLVNFGSTCYMNSIIQSLSATTEL
TKFFFNNHFHTVVQKNWKGSQGVLPGLYANLVRSLWKNDVEVIRPTSFRKFIGRLNSEWA
GSQQQDAKEFFDVLVDCLHEDLNVNWQRTPLRPLTTEQEMRRERMPIHQVSGIEWNRYCH
REFSYISSLFAGQHASRLRCTTCRRTSTTYEAFYSISVEIPPSGKGDIYQCLRSYCQEEM
LSGDEVWKCPHCRTEREATKQIILTRAPQFLVLHFKRFSASHRQQARKIHTPVYFPLSGL
DMTPFMIQPPSTPPSQPQPNGNPAQTSAVSQSQTELSPNDLATSSPFIYNAYAVVRHLGS
TIHEGHYISLVRDANRDCWRKFDDHRVTDFQPGNPGSSDCLQSEQAYLVFYERAPRN
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcaccatccacggtgggcaggccagttctcggggcttatgatggctgtcaat
tcccaacacgctaccatggagaatatcaagcggaagcttagttcgcagcataatccgagc
tacggtcatgagtccagccagtcgcggccaaattcggggggttataatgcttcgccaatc
ctgccttcggaatcctctcgttacgaagcagcgcaagatccccgcgatatccccattcgc
atgccaagtccctcaagcttccaatgctcgccgacaataccagcaatactgcaaatgcca
gggtcaccgtcgaggaaaatcaaacctgaagtgaaacccaaaccggaaaatctaatgggg
aagcctacagaggagaaaacaacgatgcgggatcctctcacgcagcgatttgccgagtta
aggaattcgcacataaagaggactccaatcgactatagtggtacaactctaaataatggc
acctgggctcctccgtccgcagactctcatacatcccaacctctctcgcattcgcgccct
cgctcagcgttggatccaccacctcctcgcccactgggccccagggagatgaattctcat
cgtactgaccccccagctccacccccgaaagtgcccatttcatcggttgaaccatccctt
ccaagagttcctagccctgcatatagtccggtgactaccgtcccatcccaaccgcctccg
aatcctcccaggacttccgttgatagcattcgccctgtatcctgccgacaatcctcttct
tggatgggtgtatcgaacgagactcttaccgtcgttgatgataacccatatcgatcccgt
accccgaacggtatgaatgcagaaggagagctaaggaataatacagcagatatgactgtc
ggtgaatcaatttccgctgaagatttactgcaatttttgcgaaaatacgacattctgctt
atcgatgtccgtccgcgagatcagtatgacagtggccatatatattcaaagtctataata
tgtatcgagccggtcatcctcaaggaaaacatgtccgcggaagagctcgaggatcgttta
gtaatatcaccagaagctgaacaatcactattttccaagcggaacgaatttgatctcatt
gtgtattacgatcaaaatacaagtgatccgtcatacctctctggttctccagcgtcgagc
gctgtgcctcatcttagagctctttacgacacactatacgaatttaatatgtataagccg
ctcaaatatggccgacagccagcttttcttgtcggaggactggatgcttgggtggacctt
gtcggtcagcagtcactatcaaccacgcacaccgcagctattatgcactctgtacgggca
cgcaaacccgttccgggaaagtaccagccattgaggaggatgccaactgccagtgccaat
tcaagctgggaggtgaagaaaaggagattacgtgaattcaaacctttgaacccagaggaa
gaacgggcgtggctggaaaaggcaaagactgaagagatcgatccatccagctatggtgca
ggtgatggcgttattactgaggaacccgaagacctcgaatcggctgaagccgaactgagc
tcctcttttgttcattcgtatgaagacttccttcgacggtttcctgaacccggagacatt
cgacagtctatggctggtcttcccatgaccgaccatcaatccactcaattccatgagcca
ctaatcgcacatccttctcggccgccaccagcggtgccccgtccatcttatagcggtgtt
actgatggccgacatatccaaccctcttttgcacgtcaagcctctgccacgaagcatgca
ttgtataaagccagttctccacttgatcgtattaaacttcctcgaaccggcctcgttaac
tttggatcaacctgctatatgaattcgatcattcagagtttaagcgcaacaaccgagctg
accaagttcttcttcaataatcatttccatactgtcgttcaaaagaactggaagggctca
caaggtgttctaccgggactttatgccaacctagtacggtcgttgtggaagaatgatgtt
gaagtcattcggcccacctctttccgaaaatttattggacgcttgaattccgagtgggcg
ggtagccagcagcaagatgccaaggagtttttcgatgtacttgtcgactgcctgcacgaa
gatcttaatgtaaactggcaaagaactcccctgcgtccactgacaacagaacaagaaatg
cgccgtgagcgaatgccaatacatcaagtctcgggaatcgaatggaaccgatattgccac
cgtgaattctcttatatatctagtcttttcgccgggcaacatgcaagtcgcttacgttgt
acgacgtgtcggcgtacctctactacctacgaggctttttatagcatcagcgtagagatc
ccaccatccgggaagggcgacatttaccaatgtctccgcagttattgtcaagaggagatg
cttagcggggatgaagtttggaaatgccctcattgtcgcactgagagagaggccacgaag
caaatcatcctgactcgtgcgccccagtttcttgtcctccattttaagcgattttccgca
tctcaccgccaacaagctcgcaagatacatacaccggtgtacttcccactctcaggctta
gacatgactccttttatgattcagcccccttccactccgccttctcagcctcaacccaat
gggaatcccgcccagacgtctgcagtgtcacaatctcagaccgaactttcgccgaatgac
ctggcaacgtcttctccgttcatttacaatgcctatgccgttgtgcgacacttgggatcg
acaatccatgaaggccactacatttctctggttcgggacgctaatcgcgactgttggcgc
aagtttgacgaccatcgtgtcacagattttcaacctggcaacccaggatcgtctgattgc
cttcagagcgaacaggcgtatctggtgttttacgaacgcgcccccagaaattaa

DBGET integrated database retrieval system