KEGG   Coccidioides immitis: CIMG_01510Help
Entry
CIMG_01510        CDS       T01114                                 

Definition
similar to acetyl-coenzyme A synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cim  Coccidioides immitis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CIMG_01510
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CIMG_01510
   00620 Pyruvate metabolism
    CIMG_01510
   00640 Propanoate metabolism
    CIMG_01510
  Energy metabolism
   00680 Methane metabolism
    CIMG_01510
Enzymes [BR:cim01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CIMG_01510
Lipid biosynthesis proteins [BR:cim01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CIMG_01510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 651 aa AA seqDB search
MNEYNQLYQQSINDPDTFWARMARDLITFEKDFDKTHIGTLEGGDNAWFVGGRLNASFNC
VDRHAMRDPNKVAIIYEADEPGHGRSITYAELLKEVSRLAWVMKSQGVRKGDTVAIYLPM
IPEAIFALLACARIGAIHSVVFAGFSSDSLRDRTLDARSKFIITTDEGKRGGKVIGTKKI
VDEALKQCPDVTNCLVFKRTGADVPWTKGRDLWWHEEVDKYPNYLPAESMDSEDPLFLLY
TSGSTGKPKGVMHTTAGYLVGAAATGKYVFDIHPADRFFCGGDVGWITGHTYVVYAPLLL
GCTTVVFESTPAYPNFSRYWDVIEKHKVTQFYVAPTALRLLKRAGDHHINHEMKDLRILG
SVGEPIAAEVWKWYHEVVGKRQAHIVDTYWQTETGSHVITPLGGITPTKPGSASLPFFGI
DPVILDPVTGAEIPGNDVEGILAFRKPWPSMARTVWGDHKRYMDTYLNVYKGFYFTGDGA
GRDHEGYYWIRGRVDDVVNVSGHRLSTAEIEAALIEHHCVAEAAVVGVPDPLTGQAVHAF
VALKSGNDNREQLQKELIMQVRKSIGPFAAPKVVFVIDDLPKTRSGKIMRRILRKILSGE
EDSLGDISTLSDPSVVNKIIDTFHEWKKAMAAAAAAAAAVSATAPPNSTTG
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatataaccagctctaccaacaatctatcaatgatcctgacaccttctgggcg
cgcatggcgcgcgatcttattactttcgaaaaggatttcgacaagactcacattgggacc
ctcgaaggcggggataatgcctggtttgtcggtggtcgattaaatgcgtccttcaactgc
gttgatcgccatgcaatgcgtgacccgaacaaggttgcaatcatctatgaagccgatgag
cctggccacggccgcagtattacctatgcagaattgttgaaggaagtctccagactggcc
tgggtgatgaagagccaaggtgttaggaaaggcgataccgtcgcgatttatcttcctatg
atccctgaggccatcttcgcgcttcttgcctgtgcgcgtattggcgccattcattctgtg
gtctttgcgggcttctcttccgattccctgcgtgatcgtaccctggatgcccggtcaaaa
ttcattatcacaaccgatgagggaaagcgtggtggaaaagtcattgggactaagaaaatt
gttgatgaagctttaaaacaatgcccagatgttaccaattgccttgttttcaagagaact
ggggccgacgtgccttggaccaaaggccgtgacctgtggtggcatgaagaggttgataaa
tatccaaattatctgcctgctgagtcaatggactctgaagacccgcttttccttctctac
acatctggctccaccgggaaaccaaagggtgttatgcacacaactgctggctaccttgtt
ggagcagctgcaactggaaaatatgtctttgatattcacccagctgaccgttttttttgc
ggtggtgatgttggatggattactggacatacttatgttgtctatgctccattgcttttg
gggtgcactactgtggtgtttgaaagcacaccagcgtatcccaatttctcgcgatactgg
gatgttattgagaagcacaaggtcacccagttttatgtagcacctacggctttgcgcctg
ttgaaacgtgcaggtgaccaccacataaatcatgaaatgaaggatttacgtattctgggc
tctgttggtgaaccaatcgctgcagaggtttggaagtggtaccatgaggttgttgggaaa
agacaagcccatattgttgatacatactggcaaaccgagaccggctcccatgttatcacc
cccttgggtggtattactccaactaaaccaggaagtgcttcgcttccattctttggtatt
gaccctgtcattctggatccagttacaggtgcagagattccgggaaatgatgtggaggga
atccttgctttcagaaagccatggccaagcatggctcgcactgtatggggcgatcataaa
cgatacatggacacctatctcaatgtttataaaggcttttatttcactggtgatggcgct
ggacgtgatcatgaaggctattactggattagaggtcgtgtggatgatgttgtgaacgtc
tctggccaccgcctttcaactgcagagatcgaagcagcacttatcgaacaccactgtgtt
gcagaagccgcggttgttggagttcctgatccgctaactggacaagctgtgcatgcattt
gtggccctgaagagtggaaatgacaatagagaacagctccaaaaggagttgattatgcaa
gtccgcaaatcgattggaccatttgctgccccgaaggttgtgtttgtgatcgatgacctt
ccgaaaacacgtagcgggaagatcatgagacgcatcttgcgaaagattctgagcggtgag
gaggacagtcttggtgacatttcaacgctctcggatcctagcgtcgtgaataaaatcatc
gacactttccacgaatggaaaaaagctatggcagctgccgccgccgctgctgctgctgtg
tcagcaaccgcgccaccaaacagcacaaccggttaa

DBGET integrated database retrieval system