KEGG   Coccidioides immitis: CIMG_01524Help
Entry
CIMG_01524        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CIMG_01524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1104 aa AA seqDB search
MAATMPAEYENATVEEDENMADSEQDAEGEDDVDMYHPLTAPGNFGGSEYVGTQHGLAAL
SAEPNHVNTVEETAQKVERTGALDSADINENNGDNERVRPVKYLPVDYKSESDADDAGDV
DPSFTNEESESARDVVSNQSSDDDSEVDEDWEAESDDRDSADAEDLTLNNCIVCGQDEEH
DPSEEFEEPLVCAVCGDHCHRQCAREQECLNDADDTDKWRCPSCVQNKLEADPGDRVEAH
RRSIVSNIAKELLPAHSDALGPDSHSIFDNPILDDDPLDGSRSLRKRKASIDEVDNSRPL
TRKRLRRTIDDQTDVAQSNEDAGDRAADNSNPSSRPSRPRRARRSQNGLCSVVLRQHGRL
VLSFHLDREKLSNVLKSRPRSRTQRRRPPKPPVIPEEPPPPQFPPIISTPYTAPFYSFHE
KEDHELNSKPYGGILADADADTSKTVPQQSDRDKFEVARQKAEEEWRQKILAAEQSGEGS
PQASQKLSGPPSKMKCINFGGFEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDFVAWR
HKLKCPVKHPPGDEIYRDGTISVFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLF
YVMTEYDELGFHFVGYFSKEKRPSSSNNVSCILTLPIHQRKGYGNLLIDFSYLLTRIERK
VGSPEKPLSDMGLVSYRNYWHLVLSYQLRDQRTPTSIGELSERTGMTPDDVVSGLEGLRA
LVRDPVTKTYALRLNYTYFEEVIQNWEKKGYVQLNPDALVWTPYVMGRSNQSHYDRAPLH
AVAPRDDHEEAIDDGDINPFENGNGLSGLNEQSTNHDCGATSGQNHVDSVPQFEAPGPPS
MEVMSYGGQSMKHSNGYSTPSVTSTIPSANIPPTRFEIFPPIQSAAVKRRPGRPFGSTKK
TRPNATNASPVRTSGRNTPRKNYNLTLATPTPAVRASPGLRRGRSKLLDNTLQTDGPADE
PGYECVEHGNEDQDGSRSGAAGVGDEDIQLKVNGEIHFDGDNVQNGARDTNESKSTNGSV
EACQGPETNLVTRVKDQRDNVSELESGGAAQQLTADILAASKIPTGKDGHTQNHPSHDER
DTSQNSIGGERNFEAAPVSASAES
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaccatgccggccgagtacgaaaatgccaccgtggaagaggatgagaacatg
gcagacagcgagcaagatgctgaaggagaagatgatgtggatatgtaccatccattaacg
gcgccaggtaattttggtggcagtgaatatgtcggtacacaacatggacttgccgcactc
agcgctgaaccgaaccatgttaataccgtggaagagaccgcccagaaggtcgaaaggact
ggtgcattggacagtgcagatataaatgaaaataacggcgataacgagcgtgtgcgaccg
gtaaagtatcttcctgtggactataaatctgaaagcgatgcggacgatgcgggcgatgtg
gacccaagcttcacaaacgaagaaagtgaaagcgcgagagatgtcgttagtaatcaatct
tccgacgacgattcagaagtcgatgaggactgggaggccgagagtgatgacagggattct
gcagacgctgaagatttgacgctgaataactgcatcgtttgtggtcaggatgaagaacat
gacccgagcgaagagttcgaggaacctttggtttgtgctgtctgtggagatcactgccac
cggcaatgcgcacgcgaacaggagtgtctcaacgacgccgacgataccgacaaatggaga
tgtccttcatgcgtccaaaacaaattggaagccgaccccggcgaccgtgttgaagctcac
aggaggtcaattgtatcaaacattgcgaaagaattacttccggcgcacagcgatgcactt
ggcccagattctcattccatattcgacaaccctatccttgatgatgatcccctcgatggc
tctcgctctttgaggaaaaggaaggcttcgattgatgaagtcgataacagccggccactc
acccgaaaacgattgcgaaggaccattgatgatcaaacggatgttgcccagtcgaacgag
gatgcgggtgatcgggctgcagataattcaaatccatcgagccgtccatctaggcctcga
agggctaggagatctcaaaatggcctctgtagcgtggtcttgaggcagcatggcagatta
gttctttcgtttcacttggatcgcgagaagttaagcaacgttttaaaatccaggccccgc
tcgagaacgcagagacggagaccaccaaagccaccggttatcccggaagaacctccgcct
ccacaatttccaccgattatttcaacgccatatacagctcctttctattcgtttcatgaa
aaggaagatcatgagctcaattcgaaaccctacggtggtatattggctgatgccgatgcg
gacacctccaaaacagtgccgcagcagagcgacagggataaattcgaggtcgcacggcaa
aaggccgaggaagaatggaggcaaaaaatattggctgccgagcaaagcggtgaaggttcg
cctcaggcttcgcaaaagctgtctgggcctccaagtaaaatgaaatgcattaattttggt
ggcttcgagatcgagacatggtacgcggcgccgtatcccgaagagtatagccgcaatagg
gtcctctatatatgcgaattttgtctcaagtacatgaactccgactttgtggcctggagg
cacaagctcaaatgcccagtaaaacatccacctggagacgaaatatatcgcgatgggacc
atctcagtcttcgaagtcgatggccggaaaaaccctgtttattgtcagaacctttgtttg
ctcgccaagctgttccttggatccaaaacgctatattatgatgtcgaacctttcctattt
tacgtgatgaccgagtatgatgaacttgggttccattttgtcggctatttcagcaaagaa
aagcggccaagctcatcaaacaatgtctcctgtatactgacgcttccaattcaccagagg
aagggttatggtaacctcttaatcgacttttcatacctccttacccgaatagagcgcaag
gttggatctcctgaaaagccactctctgatatggggttggtttcatatcgaaattactgg
cacctcgtgttgtcatatcagcttcgcgatcagagaactccgacaagtatcggcgaactt
tccgagcgcaccggaatgactcccgatgatgttgtgtccggtctagaaggattgcgtgca
ctcgtacgtgaccctgtcacgaagacctacgccctacgtttaaattacacttattttgaa
gaagtcattcagaattgggagaagaaaggctacgttcagttaaacccggatgctcttgta
tggacgccgtatgttatgggtcgtagcaatcagtcgcactatgatcgtgcgcctctccat
gctgtggcgccacgggatgatcacgaagaggccattgatgatggagacatcaacccattc
gaaaacggcaatggtctatcgggcctcaacgagcaatcaaccaaccacgattgtggtgcc
actagcggtcaaaaccatgtcgattctgtgcctcaattcgaagccccagggccgccatca
atggaagttatgtcatacggtggacaatcgatgaagcatagtaatggctacagcacccca
tctgtaacctctacaattccatccgccaacattccaccaacgaggttcgagattttccca
ccaatacaatcggctgcggtcaaacgccgtcccggtcgaccttttggaagcaccaagaag
acgcgtcctaatgctaccaatgcatccccagttcggactagtggtcgcaatactcctaga
aagaactacaatctcactctagctacccccactccggctgtacgcgcatcccctggtctc
cgtagaggacgcagcaagttgcttgacaatacccttcagaccgatggaccagctgatgaa
ccaggatacgaatgtgtggagcatggtaacgaagatcaagatgggagtagatcaggagcg
gctggtgttggcgatgaagacatccagctaaaggtcaatggtgagattcactttgatggg
gacaatgtccagaatggtgctcgagacacaaatgagtcgaagagtacaaatggtagtgtg
gaagcctgccagggtcccgaaacaaaccttgtaaccagagtcaaagaccagagggataac
gtttctgaactcgagtcaggcggtgcagctcaacaactgactgctgacattttggccgcc
agcaagatacctactggaaaggacggacatacccaaaaccatcctagccacgatgagcgt
gatacctctcagaatagtatcggtggagaaaggaatttcgaagccgcacccgtatctgca
tccgcggaaagctag

DBGET integrated database retrieval system